BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A03 (281 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0485 - 3444240-3444398,3444507-3444572,3444644-3444724,344... 28 0.97 02_05_1133 + 34346894-34347121,34347222-34347283,34347373-343474... 28 1.3 11_06_0061 - 19702893-19703869,19703960-19704098,19704166-197042... 26 3.9 06_01_0809 - 6100025-6100251,6100456-6100565,6100919-6100986,610... 26 3.9 12_02_1225 - 27164595-27164842,27164959-27165133,27165213-271653... 26 5.2 10_01_0260 - 2726204-2727370 25 6.8 07_03_1178 - 24580294-24580727,24581749-24582274 25 6.8 02_02_0236 + 8135641-8135795,8136167-8136557,8136640-8136931,813... 25 6.8 10_08_0749 - 20282982-20283632,20284081-20284141,20284828-202848... 25 9.0 >06_01_0485 - 3444240-3444398,3444507-3444572,3444644-3444724, 3444823-3444900,3444980-3445075,3445363-3445405, 3445498-3445571,3445693-3445781,3445887-3445935, 3446171-3446227,3446309-3446425,3448633-3448698, 3449140-3449196,3449271-3449363,3449515-3449662, 3449753-3449902,3449979-3450181,3450319-3450438, 3450530-3450694,3450784-3450870,3450951-3451100, 3451225-3451365,3451399-3451569,3452015-3452091, 3452175-3452415,3452495-3452758,3452913-3453000, 3453099-3453481 Length = 1170 Score = 28.3 bits (60), Expect = 0.97 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 61 KATLCSRSPLSRATPSSGSESNQPPLKVLXSLNSCSVIITYLMSTLICITNIKNI 225 KA + + +P + +SNQ L + S N C+ II Y T + N+ +I Sbjct: 442 KAQIETGTPYMLYKDTCNRKSNQQNLGTIKSSNLCTEIIEYTSPTETAVCNLASI 496 >02_05_1133 + 34346894-34347121,34347222-34347283,34347373-34347460, 34348005-34348268,34348346-34348586,34348672-34348748, 34348837-34349007,34349084-34349176,34349257-34349406, 34349491-34349577,34349656-34349820,34349900-34350019, 34350244-34350446,34350547-34350696,34350779-34350926, 34351046-34351129,34351207-34351308 Length = 810 Score = 27.9 bits (59), Expect = 1.3 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 61 KATLCSRSPLSRATPSSGSESNQPPLKVLXSLNSCSVIITYLMSTLICITNIKNI 225 KA + + +P S +SNQ L + S N C+ II + T + N+ +I Sbjct: 395 KAQIETGTPYMLYKDSCNRKSNQQNLGTIKSSNLCTEIIEFTSPTETAVCNLASI 449 >11_06_0061 - 19702893-19703869,19703960-19704098,19704166-19704287, 19704362-19704416,19704508-19704624,19704718-19705413, 19706358-19706393,19707190-19708236 Length = 1062 Score = 26.2 bits (55), Expect = 3.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 61 KATLCSRSPLSRATPSSGSESNQPPL 138 K + CS SP S G E QPPL Sbjct: 27 KGSQCSSSPRSPRPGGGGVEGEQPPL 52 >06_01_0809 - 6100025-6100251,6100456-6100565,6100919-6100986, 6101108-6101229,6101446-6101527,6101629-6101695, 6102811-6102883,6103032-6103148,6104167-6104259, 6104430-6104495,6105121-6105218,6105917-6106016, 6106486-6106660,6106828-6106894,6107574-6107712, 6107830-6107926,6107992-6108130,6108212-6108363 Length = 663 Score = 26.2 bits (55), Expect = 3.9 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 54 DLEGDVVFKVTIVKSYAVFWVGIESAPVKG 143 +L+ D+ V I+ + FW + P+KG Sbjct: 294 ELKSDLDIPVEIINKFEEFWAASRATPLKG 323 >12_02_1225 - 27164595-27164842,27164959-27165133,27165213-27165307, 27165391-27165444,27165794-27165868,27165961-27166081, 27166494-27166549,27166698-27166762,27166962-27167050, 27167155-27167812,27168182-27168202,27168777-27168859, 27169081-27169136,27169413-27169619,27170628-27170760 Length = 711 Score = 25.8 bits (54), Expect = 5.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 85 PLSRATPSSGSESNQPPLKVLXSLNSCSV 171 P R + G+ SNQ LK + S+ CSV Sbjct: 595 PPKRIIATGGASSNQIILKTMASIFGCSV 623 >10_01_0260 - 2726204-2727370 Length = 388 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +3 Query: 60 EGDVVFKVTIVKSYAVFWVGIESAPVKGSXVIKFMFSH 173 +GDVVF T+ + V+ ++ V GS ++K ++S+ Sbjct: 333 DGDVVFIRTVAGVFLVWLDTLKFKKVSGSLLMKTVYSY 370 >07_03_1178 - 24580294-24580727,24581749-24582274 Length = 319 Score = 25.4 bits (53), Expect = 6.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 103 PSSGSESNQPPLKVLXSL 156 P++GS QPPL+ L SL Sbjct: 214 PANGSMKEQPPLRTLRSL 231 >02_02_0236 + 8135641-8135795,8136167-8136557,8136640-8136931, 8137117-8137271,8137363-8137451,8137623-8137967, 8139046-8139169,8139424-8139581,8139673-8139757, 8140094-8140306,8141314-8141375,8141466-8141951, 8142472-8142568 Length = 883 Score = 25.4 bits (53), Expect = 6.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 30 LTPWTAPKDLEGDVVFKVTIVKSY 101 LT +TAP+DL+G+ ++K +Y Sbjct: 551 LTQFTAPEDLDGENMYKCGRCSAY 574 >10_08_0749 - 20282982-20283632,20284081-20284141,20284828-20284872, 20285293-20285672,20286382-20287050 Length = 601 Score = 25.0 bits (52), Expect = 9.0 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 10 IRQTDCFLPLGQLLRT*KATLCSRSPLSRATPSSGSESNQPP 135 +R + LP QLL+ CS S +PSS S++ +PP Sbjct: 146 LRGSRFLLPTQQLLQE----FCSLPVKSTTSPSSASKATKPP 183 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,818,993 Number of Sequences: 37544 Number of extensions: 96344 Number of successful extensions: 272 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 14,793,348 effective HSP length: 70 effective length of database: 12,165,268 effective search space used: 279801164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -