BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A03 (281 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 23 2.8 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 21 8.7 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 22.6 bits (46), Expect = 2.8 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 97 ATPSSGSESNQPPLKVLXSLNSCSVIITYLMSTLICITNI 216 AT E +QP ++ ++ SCS + LM L+ + N+ Sbjct: 93 ATKVLKEEKDQPLIQPYGNIKSCSFFKSLLM-VLVLLINV 131 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 83 HHCQELRRLLGRNRISPR 136 HH Q+ ++++G+N + R Sbjct: 788 HHLQQQQQIVGKNTLYSR 805 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,263 Number of Sequences: 2352 Number of extensions: 3559 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 16515522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -