BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A02 (535 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 24 0.85 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 1.1 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 3.4 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 21 6.0 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 21 6.0 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 24.2 bits (50), Expect = 0.85 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 212 NTESLNKALKEGSDSMVQQVSELSNS 289 NTESL K+ +G+D ++V ++ +S Sbjct: 278 NTESLMKSENQGNDVQYERVQDVFDS 303 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -2 Query: 396 SGCALRRSSTVRSKFWRACWSTSLALPFASVNAPCRLLD 280 +GC L + ++K+ RAC + SL L + R+LD Sbjct: 366 AGCDLTIDNLRKAKYLRACITESLRL-IPTTTCIARILD 403 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.2 bits (45), Expect = 3.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 244 RLRLHGAAGLRVIQQS 291 RL++HG GLRV S Sbjct: 564 RLKVHGIRGLRVADAS 579 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 21.4 bits (43), Expect = 6.0 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +2 Query: 359 ERTVEDLRKAHPDVEKQATALHEKLQTAIQNTLKESQNLAKEV 487 ++TV+D+ + + DVE + + + N + ES N + + Sbjct: 41 QQTVDDINEVNFDVEDEKPQRYNECILKQFNIVDESGNFKENI 83 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 21.4 bits (43), Expect = 6.0 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +2 Query: 359 ERTVEDLRKAHPDVEKQATALHEKLQTAIQNTLKESQNLAKEV 487 ++TV+D+ + + DVE + + + N + ES N + + Sbjct: 41 QQTVDDINEVNFDVEDEKPQRYNECILKQFNIVDESGNFKENI 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,893 Number of Sequences: 438 Number of extensions: 2610 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -