BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_A01 (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 2.6 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 3.4 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 23 4.5 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 136 SQPGASRYPFLTRQRLPCCCDIPVEIN 56 S PG S+ P L R+ P C + +I+ Sbjct: 1147 SGPGGSKTPILNRKEKPKSCSVCRQIS 1173 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 3.4 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 64 RPEYRNNMAAAVVSGKDIEKPQAEISPIHRIRITLTSRNVRSLEK 198 R E N A KD+EKP+ E + TLT + ++K Sbjct: 269 RTEKHNRCKLAEREMKDLEKPKTEAVEYLKQENTLTRTRNQQIQK 313 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 82 CCDIPVEINNFQIKNCSALN 23 CC IP I+N ++ C A N Sbjct: 37 CCKIPKPIDNAIMEKCRAEN 56 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,990 Number of Sequences: 2352 Number of extensions: 12151 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -