BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P24 (579 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 s... 27 2.0 SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces pomb... 26 4.6 SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac... 26 4.6 >SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 subunit Alp6|Schizosaccharomyces pombe|chr 2|||Manual Length = 821 Score = 27.1 bits (57), Expect = 2.0 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 350 FLXLMAPI-KSXXSXNKYTLDEKFTSSSRQYQSEVETIDFSDTK 478 FL L++PI +S + + LDE ++ +EVE+ +F T+ Sbjct: 99 FLYLLSPISQSSRDVSSHLLDESISNPINIPSTEVESSNFGQTR 142 >SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 510 Score = 25.8 bits (54), Expect = 4.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 213 LMLLYKSGAGEGSRVEIDKFLGDVDYSEATNP 308 L+ K G+G G + + FLGD+ Y + P Sbjct: 243 LLAFDKIGSGSGDLSKCESFLGDILYMVSKEP 274 >SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 882 Score = 25.8 bits (54), Expect = 4.6 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = -3 Query: 301 VASL*STSPKNLSISTRLPSPAPDL*RSISIITPNGEDTTFLSFPDVYASLRS 143 VAS TSP L+++ + PSP P S + +T T SLRS Sbjct: 549 VASPLKTSPVKLAVTPQAPSPLPSSNPSQASLTEESLSTRSSPTKPSTTSLRS 601 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,292,109 Number of Sequences: 5004 Number of extensions: 45739 Number of successful extensions: 127 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -