BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P23 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45852| Best HMM Match : I-set (HMM E-Value=0) 29 1.9 SB_5144| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_32019| Best HMM Match : Ion_trans_2 (HMM E-Value=1.6e-15) 29 3.3 SB_59790| Best HMM Match : VWA (HMM E-Value=0) 28 5.8 >SB_28068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Frame = +2 Query: 167 LHDYSLNAHYYYHHLTYNKWL------GGDVVPLLKERRGEWYWFVHKQLVTRYYMERL 325 L Y L H Y+ + N+ G ++P+ ++ W WF HK+ TR Y++ L Sbjct: 11 LKKYELTIHEIYNDASSNRQSCSKTKSNGKILPVKRKWTWMWRWFTHKE--TRRYVDML 67 >SB_45852| Best HMM Match : I-set (HMM E-Value=0) Length = 1122 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 101 VVIRSNTTVW-HYHCQSASMSYYLHDYSLNAHYYYHHLTYN 220 ++I T++ HYH +Y H H+++HH YN Sbjct: 1020 IIITIIITIFNHYHHHRRRHHHYHHQQQHQFHHHHHHTHYN 1060 >SB_5144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 361 TTKFTDFTKSIRKSFHIVTCYKLFVYEPVPF 269 TTK + TK K FH + C++ EP+ F Sbjct: 196 TTKSEEITKQFEKVFHGIGCFQDKTGEPIEF 226 >SB_32019| Best HMM Match : Ion_trans_2 (HMM E-Value=1.6e-15) Length = 299 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 134 YHCQSASMSYYLHDYSLNAHYYYHHLTYNKWLGGDVVPL 250 Y C A + YL ++S +Y +T++ GD+VPL Sbjct: 138 YLCLMAGLGMYLEEWSFLDSFYAWFITFSTIGFGDLVPL 176 >SB_59790| Best HMM Match : VWA (HMM E-Value=0) Length = 4151 Score = 27.9 bits (59), Expect = 5.8 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 9/67 (13%) Frame = +2 Query: 236 DVVPLLKERRGEWYWFVHKQLVTRYYMERLSNGF-----GEIGELSGNVVNEGYN----F 388 D P + + G +W V+K+L RY + R +N F G I + V Y+ F Sbjct: 3241 DYNPSSRNKWGVHFWIVNKRLFVRYTV-RKTNDFTAALMGRIKSNTWEYVGTSYDWNTGF 3299 Query: 389 GYMYHNG 409 Y++ NG Sbjct: 3300 AYLFRNG 3306 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,292,180 Number of Sequences: 59808 Number of extensions: 378023 Number of successful extensions: 1190 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -