BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P22 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 27 2.4 SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|ch... 27 2.4 SPBC1711.03 |||conserved eukaryotic protein|Schizosaccharomyces ... 26 5.5 SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyc... 26 5.5 SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 25 7.2 SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces ... 25 9.5 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 178 MLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLD 291 M+ +D EP +S C LL + D + MVS E + Sbjct: 1281 MVESDYEPDVSLCPELLSLAIDFPGDPFVMVSKMEKYE 1318 >SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 27.1 bits (57), Expect = 2.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 421 PIKDCTSVDLQCRHHLPLSR 362 P K+C + L+C +H+P SR Sbjct: 46 PCKNCKAGKLECTYHMPSSR 65 >SPBC1711.03 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 258 Score = 25.8 bits (54), Expect = 5.5 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 144 SKSYIRESXSTYAAYGLGACSFVLHPSAVQ 233 SK IRE AY L ACS L P +++ Sbjct: 44 SKEEIREQRLLQRAYALRACSNSLLPESIE 73 >SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 489 Score = 25.8 bits (54), Expect = 5.5 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 58 SPGYWR*RLRLPTTQHHLVAKAKSSATMTARAISENLQARMLPTDLE 198 SP + RLR Q L A KSS+T T+ + L+A LP++ E Sbjct: 356 SPSVLQERLRAAVNQQPLDA-LKSSSTQTSIPKIQKLKAAKLPSEEE 401 >SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 430 QARTAFTNSALLLAEQYGFDGIDLSWQLPK 519 Q T F S+L +A G+D I L W L K Sbjct: 531 QGVTEFVPSSLGVALAKGYDEIGLEWSLTK 560 >SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces pombe|chr 3|||Manual Length = 1364 Score = 25.0 bits (52), Expect = 9.5 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 1/88 (1%) Frame = +1 Query: 118 KAKSSATMTARAISENLQARM-LPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDI 294 K K R +SE + R L +E + C+ L ++ Q D Y + N++ + Sbjct: 1084 KLKVEVERRRRLLSEKEERRKELAIKIEQVTNSCSDLELRTNAEQ-DFY---AKNQDFEF 1139 Query: 295 DRAHANYRAITNLKRQFPQLRVFLTVGG 378 D + NLK + V LT GG Sbjct: 1140 DEIKRYEEQLLNLKNELGWTIVSLTAGG 1167 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,430,550 Number of Sequences: 5004 Number of extensions: 46396 Number of successful extensions: 148 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -