BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P21 (295 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 1.8 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 3.1 AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 21 7.2 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 21 9.6 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 21 9.6 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 84 FYALQGSCVTTVKWSPPWHR 25 F AL SC+ T + PW R Sbjct: 519 FQALYQSCLETATFPAPWKR 538 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 11 NECMMRCHGGDHLTVVTH 64 NE +M+ G + LTV+TH Sbjct: 606 NEMVMQKEGENELTVLTH 623 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 37 R*PLDGRNARTLQCVEEP 90 R PLD N +QC EP Sbjct: 40 RHPLDDCNDHLMQCCAEP 57 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 148 IMISTYY*ES*KENAIINHLVLLRIARFVRY 56 I + YY ES ++ + + + L+ RF RY Sbjct: 242 IFVEVYYAESPRKEILPHEVGLILSNRFGRY 272 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 211 VISDNMLLNCC 243 V+ N LLNCC Sbjct: 17 VVVQNSLLNCC 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,218 Number of Sequences: 2352 Number of extensions: 3981 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 18253998 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -