BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P20 (442 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_54844| Best HMM Match : Microvir_J (HMM E-Value=1.7) 29 1.3 SB_44479| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_29132| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_5699| Best HMM Match : DUF689 (HMM E-Value=3.8e-10) 28 3.9 SB_1018| Best HMM Match : adh_short (HMM E-Value=2.1e-33) 27 5.2 SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_17991| Best HMM Match : GRP (HMM E-Value=7.5) 27 6.9 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_1658| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.16) 27 6.9 SB_42978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_30292| Best HMM Match : fn3 (HMM E-Value=1.2e-12) 27 9.1 SB_38103| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_29649| Best HMM Match : Sushi (HMM E-Value=4.1e-18) 27 9.1 SB_24400| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_44146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 29.9 bits (64), Expect = 0.97 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 226 KQSVCLILWHASCGS--RRYLVHHS*GVARRYHRGLRSK 116 + + L+LW + GS RR+++HH G + H+ L K Sbjct: 37 RPKIALLLWVLNRGSKDRRFVIHHGQGNHKSNHKNLHKK 75 >SB_54844| Best HMM Match : Microvir_J (HMM E-Value=1.7) Length = 189 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/60 (25%), Positives = 34/60 (56%) Frame = +3 Query: 177 RRDPQDACQRIRQTDCFLPLDSS*GLRRRRCVQGHHCQELRRLLGRNRISPRKGSKSLNH 356 R++ ++ QR+++T + + GL RR+C+Q QE+R + S + +++++H Sbjct: 31 RKEAENELQRLKKT---VNNTTHLGLERRKCLQSFKSQEIRVFGSKGANSSKDETENIDH 87 >SB_44479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.1 bits (62), Expect = 1.7 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 172 NNAVTHKMHAKELDRQTVSYPWT-APKDLEGDVVFKVTIVKS 294 ++AVT K+ K DR+ +S PW P D+ V V S Sbjct: 100 DSAVTVKVRVKVRDREIISIPWVPEPPDISRPVTLSQNAVTS 141 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 29.1 bits (62), Expect = 1.7 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 124 RSKCRRSC-HPDELPGGCRPFC 62 R++C R C +P+ +PG C P C Sbjct: 250 RTECSRDCPNPEPIPGQCCPIC 271 >SB_29132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 180 GVIWFTTVE-GLREGIIGAYGPSADDLVTLTSFQEDA 73 GV WF ++ +R I GA GP+ + T EDA Sbjct: 285 GVSWFALLKVNIRSSIAGAGGPAMEAQTEFTKLLEDA 321 >SB_5699| Best HMM Match : DUF689 (HMM E-Value=3.8e-10) Length = 333 Score = 27.9 bits (59), Expect = 3.9 Identities = 21/60 (35%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +3 Query: 186 PQDA-CQRIRQTDCFLPLDSS*GLRRRRCVQGHHCQELRRLLGRNRISPRKGSKSLNHVS 362 P D C R+R +P S R HH + LR R R P K K LN VS Sbjct: 257 PTDVDCGRVRGLAAVIPSLSIGNFRISILGIEHHKRRLRPCDKRKRAGPNKNVKQLNGVS 316 >SB_1018| Best HMM Match : adh_short (HMM E-Value=2.1e-33) Length = 717 Score = 27.5 bits (58), Expect = 5.2 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 64 KMAGILL-EARQGDKIVGTWTV---SPDD-TFSQPLNCGEPNNAVT 186 K+ GI L ++G K+V +WTV +P F+ P G+P+ +T Sbjct: 625 KVKGIFLWHVKKGGKVVSSWTVDLKTPGGAVFTGPPKGGKPDTTIT 670 >SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1603 Score = 27.5 bits (58), Expect = 5.2 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 3/89 (3%) Frame = +1 Query: 13 KAGHSIDVVISGKTPE---DKMAGILLEARQGDKIVGTWTVSPDDTFSQPLNCGEPNNAV 183 ++G +SG P+ G L AR ++ G T +P + +P P V Sbjct: 1281 RSGEVTSTSVSGNPPKLSPVSEVGTLDFARMMEEFQGFGTSAPVPSLPEPPEI--PALLV 1338 Query: 184 THKMHAKELDRQTVSYPWTAPKDLEGDVV 270 T + +K+LDR+T P T P + E + V Sbjct: 1339 TGSI-SKDLDRKTSGLPNTTPDNAERENV 1366 >SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4538 Score = 27.1 bits (57), Expect = 6.9 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -2 Query: 168 FTTVEGLREGII-GAYGPSADDLVT-LTSFQEDAGHFVFGCFAADNHVNGMTSF 13 F T+ +++ I A+ + L+T T+F A H+ F CF AD NG F Sbjct: 2271 FGTIANVQKKISEAAFTDDSPTLITNATTFTIRASHYEFSCFVADIG-NGTVGF 2323 >SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = +3 Query: 324 SPRKGSKSLNHVSHHHLLDVNINLYYKHYKYTTIIFIN 437 SP SL+H + ++++++ + H+++ TII +N Sbjct: 279 SPFHHDNSLHHFPYISIINISLKNRHHHHQHITIITVN 316 >SB_17991| Best HMM Match : GRP (HMM E-Value=7.5) Length = 186 Score = 27.1 bits (57), Expect = 6.9 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 100 DKIVGTWTVSPDDTFSQPLNCGEPNNAVTHKMHAKELDRQTVSYP 234 D + T + S D T+ N G P + VT + LDR T +YP Sbjct: 85 DLVTNTTSASSDVTYK---NHGSPYDEVTATSTYQSLDRTTRTYP 126 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 1 VSSVKAGHSIDVVISGKTPEDK 66 V +K G I+VVIS K PED+ Sbjct: 74 VEQMKEGTVIEVVISAKVPEDE 95 >SB_1658| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.16) Length = 458 Score = 27.1 bits (57), Expect = 6.9 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +1 Query: 58 EDKMAGILLEARQGDKIVGTWTVSPDDTFSQPLNC-GEPNNAVTHKMHAKELDRQTVSYP 234 +DK+ L E +QGD+ +G T + D Q + E N ++M + D Q Sbjct: 257 KDKVISTLREGKQGDESMGAVTSAEFDEVCQERDALKEELNQTRYRMEQVKTDLQDAEQH 316 Query: 235 WTAPKDLEGDVV 270 A D+ + V Sbjct: 317 QQAEADIAQEKV 328 >SB_42978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 26.6 bits (56), Expect = 9.1 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +1 Query: 100 DKIVGTWTVSPDDTFSQPLNCGEPNNAVTHKMHAKELDRQTVSYP 234 D + T + S D T++ N G P + VT + LDR T +YP Sbjct: 9 DPVTHTTSASSDVTYA---NHGSPYDDVTATSTYQSLDRTTRTYP 50 >SB_30292| Best HMM Match : fn3 (HMM E-Value=1.2e-12) Length = 519 Score = 26.6 bits (56), Expect = 9.1 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 100 DKIVGTWTVSPDDTFSQPLNCGEPNNAVTHKMHAKELDRQTVSYP 234 D + T + S D T+ N G P + VT + LDR T +YP Sbjct: 179 DFVTNTTSASSDVTYK---NHGSPYDEVTATSTYQSLDRTTRTYP 220 >SB_38103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 741 Score = 26.6 bits (56), Expect = 9.1 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 366 HHLLDVNINLYYKHYKYTTIIFINY 440 H LL++ +N YY+ ++ ++ NY Sbjct: 425 HFLLEITMNTYYEDHEQASVDMFNY 449 >SB_29649| Best HMM Match : Sushi (HMM E-Value=4.1e-18) Length = 214 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 136 HRGLRSKCRRSCHPDELPGGCRPFCLRVFCR 44 +R + SK R +C D G P C R++CR Sbjct: 125 YRVIGSKTR-TCQADTTWSGINPSCERIYCR 154 >SB_24400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 26.6 bits (56), Expect = 9.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 342 KSLNHVSHHHLLDVNINLYYKHYKYTTII 428 K N S H+LDV+ N+Y Y Y + + Sbjct: 200 KKSNSPSAQHILDVSKNVYQSTYTYQSCV 228 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,064,533 Number of Sequences: 59808 Number of extensions: 345164 Number of successful extensions: 1200 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1196 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -