BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P19 (524 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 30 0.013 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 30 0.013 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.4 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 30.3 bits (65), Expect = 0.013 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 18 TRVNFIKMVKVDIKYTKLFINNEWVDAVSKKTFPTINPQDESV 146 T N IKM KV I + F+NN V V+ +P +NP ++S+ Sbjct: 481 TTTNDIKMQKVLIDFWVSFVNN-GVPNVNSVQWPRLNPNEKSL 522 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 30.3 bits (65), Expect = 0.013 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 18 TRVNFIKMVKVDIKYTKLFINNEWVDAVSKKTFPTINPQDESV 146 T N IKM KV I + F+NN V V+ +P +NP ++S+ Sbjct: 481 TTTNDIKMQKVLIDFWVSFVNN-GVPNVNSVQWPRLNPNEKSL 522 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 21 RVNFIKMVKVDIKYTKLFINNEWVDAVSKKTF 116 R+ + + V LFINN +++ V TF Sbjct: 606 RITELSPLSVPDSVELLFINNNYINLVRPNTF 637 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 366 VLWASGIVRYYAGKADKI 419 + WA G+ R+Y G D I Sbjct: 466 ISWAFGVNRFYDGIRDMI 483 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 366 VLWASGIVRYYAGKADKI 419 + WA G+ R+Y G D I Sbjct: 519 ISWAFGVNRFYDGIRDMI 536 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,122 Number of Sequences: 438 Number of extensions: 2362 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14722920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -