BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P16 (556 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 25 0.68 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.68 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.2 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 6.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 6.3 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 21 8.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.4 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 24.6 bits (51), Expect = 0.68 Identities = 11/48 (22%), Positives = 23/48 (47%) Frame = -1 Query: 421 RVMEQQWQSGRSDERGGVTPNPPHPGC*FHELRSGPLLALQSRIPDTY 278 R E +++ S ++ P P + C +EL+SG + + + T+ Sbjct: 13 RSAESEFEGASSPKKRNKNPQPKNAVCALNELKSGAVYKVVDQTGPTH 60 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.6 bits (51), Expect = 0.68 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 37 MNKIPIVILL-TFAYISRGIAESCQNPKVEATSFTSLDATV 156 M+K+P + T +YI R E QNPKV F + AT+ Sbjct: 531 MSKLPKTVRTPTDSYI-RSFFELLQNPKVSNEQFLNTAATL 570 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 58 ILLTFAYISRGIAESCQNPKVEATSFTSLDA 150 +L +F Y + E C +P ATS S+ + Sbjct: 1736 LLHSFMYHEHAMTEGCASPPPAATSMKSVSS 1766 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 58 ILLTFAYISRGIAESCQNPKVEATSFTSLDA 150 +L +F Y + E C +P ATS S+ + Sbjct: 1732 LLHSFMYHEHAMTEGCASPPPAATSMKSVSS 1762 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 289 PDTYFLQLEPL 257 PDT F+QL PL Sbjct: 152 PDTKFIQLPPL 162 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 289 PDTYFLQLEPL 257 PDT F+QL PL Sbjct: 152 PDTKFIQLPPL 162 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = -1 Query: 406 QWQSGRSDERGGVTPNPPHPG 344 +W + +E G P PP G Sbjct: 118 EWNAAHPEEDDGGQPRPPGRG 138 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 109 FGSSLRFLDLYRQK 68 FG R LDLYRQ+ Sbjct: 1006 FGCRQRNLDLYRQE 1019 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,192 Number of Sequences: 438 Number of extensions: 3386 Number of successful extensions: 20 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -