BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P13 (508 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022896-1|AAY55312.1| 421|Drosophila melanogaster IP12536p pro... 28 6.3 AY061167-1|AAL28715.1| 421|Drosophila melanogaster LD13269p pro... 28 6.3 AE014134-3584|AAF57255.1| 485|Drosophila melanogaster CG5922-PA... 28 8.3 >BT022896-1|AAY55312.1| 421|Drosophila melanogaster IP12536p protein. Length = 421 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 389 NGDRRNCKCVYYKLCDENNRLIYDNYAAMTGASLIGIRFN 508 +G C CV Y CD + + ++ + G +I IRFN Sbjct: 74 SGKTATCNCVPYYKCDPSTKSFTED-GSFDGFGVIDIRFN 112 >AY061167-1|AAL28715.1| 421|Drosophila melanogaster LD13269p protein. Length = 421 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 389 NGDRRNCKCVYYKLCDENNRLIYDNYAAMTGASLIGIRFN 508 +G C CV Y CD + + ++ + G +I IRFN Sbjct: 74 SGKTATCNCVPYYKCDPSTKSFTED-GSFDGFGVIDIRFN 112 >AE014134-3584|AAF57255.1| 485|Drosophila melanogaster CG5922-PA protein. Length = 485 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 163 SRFLGRIFRENSQWWTEYCDNS 228 + F GR FR +W YC+NS Sbjct: 211 ANFKGRTFRSPPWFWVTYCNNS 232 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,850,421 Number of Sequences: 53049 Number of extensions: 239458 Number of successful extensions: 527 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1825511424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -