BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P07 (462 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 25 0.40 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 25 0.40 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 25 0.40 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.1 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 2.8 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 2.8 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 3.7 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 3.7 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 3.7 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 3.7 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 3.7 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 3.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 3.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 3.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 3.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 3.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 3.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 3.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 3.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 3.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 8.5 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 25.0 bits (52), Expect = 0.40 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 153 RYSIQKIKSSEHD*SNCHTRSLISVWWSS 239 RY I + SEH+ +N + ++ W++S Sbjct: 399 RYEILNFRKSEHNGTNGYQYQVVGKWFNS 427 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 25.0 bits (52), Expect = 0.40 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 352 HFQIYVSTSR-FQPKHIFNESFLCCFF*NRR 263 +F Y S R FQ KH +++ C F NRR Sbjct: 14 NFSCYYSLKRHFQDKHEQSDTLYVCEFCNRR 44 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 25.0 bits (52), Expect = 0.40 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 153 RYSIQKIKSSEHD*SNCHTRSLISVWWSS 239 RY I + SEH+ +N + ++ W++S Sbjct: 489 RYEILNFRKSEHNGTNGYQYQVVGKWFNS 517 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+RKY + ++RS Sbjct: 270 KSYKNEREYRKYGKTSKERS 289 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+RKY + ++RS Sbjct: 281 KSYKNEREYRKYGETSKERS 300 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+RKY + ++RS Sbjct: 48 KSYKNEREYRKYRETSKERS 67 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+RKY + ++RS Sbjct: 48 KSYKNEREYRKYRETSKERS 67 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 48 KLYKNEREYRKYGETSKERS 67 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 48 KLYKNEREYRKYGETSKERS 67 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 48 KLYKNEREYRKYGETSKERS 67 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 48 KLYKNEREYRKYGETSKERS 67 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 48 KSYKNEREYREYRETSRERS 67 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 297 KSYKNEREYREYRETSRERS 316 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 297 KSYKNEREYREYRETSRERS 316 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 281 KLYKNEREYRKYGETSKERS 300 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 297 KSYKNEREYREYRETSRERS 316 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 297 KSYKNEREYREYRETSRERS 316 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 297 KSYKNEREYREYRETSRERS 316 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 297 KSYKNEREYREYRETSRERS 316 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 281 KLYKNEREYRKYGETSKERS 300 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 281 KLYKNEREYRKYGETSKERS 300 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 281 KLYKNEREYRKYGETSKERS 300 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 281 KLYKNEREYRKYGETSKERS 300 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K Y E+RKY + ++RS Sbjct: 270 KLYKNEREYRKYGETSKERS 289 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 296 KSYKNEREYREYRETSRERS 315 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQRS 446 K+Y E+R+Y + R+RS Sbjct: 297 KSYKNEREYREYRETSRERS 316 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 387 KTYFQSLEFRKYSTSQRQR 443 K+Y E+RKY + ++R Sbjct: 281 KSYKNEREYRKYRETSKER 299 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,123 Number of Sequences: 438 Number of extensions: 2925 Number of successful extensions: 37 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12312900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -