BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P05 (571 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 7.4 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.8 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 9.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 9.8 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 571 HPAHTTTLCAWLNTVV 524 HPA T +L W+ V+ Sbjct: 259 HPASTQSLSRWIKMVL 274 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 20.6 bits (41), Expect = 9.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 445 GNIS*RDWYHIQTLISWMSNVPVATK*LRYLATHRG 552 GNI+ W + I + NV +A L +L H+G Sbjct: 151 GNIAMELWNMPRENIEPLPNVILACHMLSFLMVHQG 186 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 20.6 bits (41), Expect = 9.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 134 GPALIMPFLMLRPIF 178 GP L++PFL+ F Sbjct: 561 GPPLVIPFLLFGGFF 575 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 20.6 bits (41), Expect = 9.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 134 GPALIMPFLMLRPIF 178 GP L++PFL+ F Sbjct: 561 GPPLVIPFLLFGGFF 575 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,417 Number of Sequences: 336 Number of extensions: 2598 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14099535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -