BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_P02 (568 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 25 1.7 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 5.3 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 25.0 bits (52), Expect = 1.7 Identities = 9/38 (23%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 426 YLHTKDYTQFEDFGPMLPKSSV-RKGIHVGDLPFHNGT 536 Y+ D F+ + ++ + +KG+H+ D+P H+ + Sbjct: 391 YIPGSDLILFQCYPSVMNLDDLTKKGLHISDIPLHDAS 428 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 5.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 426 YLHTKDYTQFEDFGPM 473 Y+H DY ED+G M Sbjct: 373 YVHDPDYRYLEDYGVM 388 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 621,394 Number of Sequences: 2352 Number of extensions: 12674 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -