BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O24 (502 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 49 3e-08 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.0 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 1.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 3.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 3.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 3.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 4.1 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 7.2 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 7.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.5 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.5 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 48.8 bits (111), Expect = 3e-08 Identities = 24/63 (38%), Positives = 43/63 (68%) Frame = +3 Query: 288 ESNNECCGVEDTVVNKIVGGNDTKITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTAA 467 +S N CG ++ ++IVGG +T I ++P + I+ +++ ++CG ++IS +YVLTAA Sbjct: 147 DSTNCNCGWKNP--SRIVGGTNTGINEFPMMAGIK-RTYEP-GMICGATIISKRYVLTAA 202 Query: 468 HCV 476 HC+ Sbjct: 203 HCI 205 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 1.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 45 ISNACKTPDDKP 80 ++NACK DDKP Sbjct: 392 LTNACKKKDDKP 403 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 81 PVYRLESYKRLKW 43 P YRLE KRL W Sbjct: 333 PKYRLELQKRLPW 345 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 133 IRPERVKWITFDNPF 177 I PER ++I F PF Sbjct: 525 INPERAEFIEFSKPF 539 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -1 Query: 394 YSITTSHGYXVIFVSFPPTILLTTVSSTPQHSLLLSSGKAVT 269 Y T+HGY + S +L ST + ++ GKA + Sbjct: 795 YPSQTTHGYDIYASSIDKENILFLDLSTGKVEMITGVGKATS 836 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 3.1 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = -1 Query: 349 FPPTILLTTVSSTPQHSLLLSSGKAVTALEHLSLRVISSGFISGGGPQH 203 F P +LL P+ + SS HL++ V+ G GP H Sbjct: 883 FAPLLLLHLTPLQPRFYSISSSPDVHQGQIHLTVAVVQYKTQDGFGPIH 931 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 4.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 455 AHCCTLCHWSNLD 493 AHC LCH + D Sbjct: 741 AHCFALCHCCDFD 753 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +3 Query: 108 EHITYMMLDKTRKSKMDYVRQSVCNGPETFSVCCGPPPEINP 233 +H+ Y +S YV +G + F+ C P P P Sbjct: 362 QHLHYRQPPTLSESYSSYVNSMYASGAQ-FATPCTPSPPRGP 402 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 99 YNCEHITYMMLDKTRKSKMDYVRQSVC 179 Y C ++DK ++++ Y R C Sbjct: 144 YACREEKSCIIDKRQRNRCQYCRYQKC 170 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 99 YNCEHITYMMLDKTRKSKMDYVRQSVC 179 Y C ++DK ++++ Y R C Sbjct: 144 YACREEKSCIIDKRQRNRCQYCRYQKC 170 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 20.6 bits (41), Expect = 9.5 Identities = 6/13 (46%), Positives = 12/13 (92%) Frame = -3 Query: 125 HISNMLTVVQTDT 87 H+S+++ V++TDT Sbjct: 13 HMSDVIEVIETDT 25 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 20.6 bits (41), Expect = 9.5 Identities = 6/13 (46%), Positives = 12/13 (92%) Frame = -3 Query: 125 HISNMLTVVQTDT 87 H+S+++ V++TDT Sbjct: 13 HMSDVIEVIETDT 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,880 Number of Sequences: 438 Number of extensions: 3342 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -