BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O22 (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31891| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_46526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_49461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_9542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_21477| Best HMM Match : 7tm_1 (HMM E-Value=2.7e-06) 29 2.7 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) 29 3.5 SB_8029| Best HMM Match : Mucin (HMM E-Value=8.6) 28 4.7 SB_13324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_37609| Best HMM Match : Extensin_2 (HMM E-Value=0.081) 28 6.2 SB_10988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_40536| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00014) 27 8.2 SB_48770| Best HMM Match : Peptidase_C1 (HMM E-Value=1.9e-14) 27 8.2 SB_25603| Best HMM Match : Ion_trans_2 (HMM E-Value=4.1e-35) 27 8.2 >SB_31891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 45.2 bits (102), Expect = 4e-05 Identities = 30/89 (33%), Positives = 44/89 (49%), Gaps = 3/89 (3%) Frame = +1 Query: 277 DLLRISEEMFNADINNAFNYIQVSL--QGKTSPMSKNDEASSNLLN-VPENVWSGPTIRP 447 +L + ++M+ AD N + ++ QGKT S++D+AS L V PT Sbjct: 2 ELSHVCDQMWKADSNRLVPEVDYAIDPQGKTRFHSRSDQASDPLFTWVNPEALRKPTYDA 61 Query: 448 FVALFDNYHKNVIRPEFVTPKEETEQNNV 534 FV L DNY +PE V +EE +N V Sbjct: 62 FVKLLDNYASETGKPEVVN-QEEINENRV 89 >SB_46526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 0.50 Identities = 30/111 (27%), Positives = 44/111 (39%) Frame = +1 Query: 235 DDMLRQVQDSTTDDDLLRISEEMFNADINNAFNYIQVSLQGKTSPMSKNDEASSNLLNVP 414 D R + S D L R E++ + N+ Y+ +L + S NDE SS V Sbjct: 22 DRSFRCLVMSACDILLKRKDEDVLHGYGNSPSQYVVTTLSYNCA--SDNDELSSVDAAVL 79 Query: 415 ENVWSGPTIRPFVALFDNYHKNVIRPEFVTPKEETEQNNVHQHYTRHRTYS 567 + ++G A N IRP + T K +N H H H +S Sbjct: 80 KQSYAGIVTLALEAAKTNSDTPQIRPHYKTAKPGLSDSNDHDH-NNHAPFS 129 >SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1028 Score = 31.5 bits (68), Expect = 0.50 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = +1 Query: 121 NLISNSVTGQQGNTAQNTLQQIGTVVGGVVDYAKKKSYDDMLRQVQD----STTDDDLLR 288 N + S+ GQ + + GG VD + DML QV D + ++DD +R Sbjct: 610 NFLGISIVGQSNKKGDGGIYVGSVMKGGAVDLDGRVEPGDMLLQVNDVNFENMSNDDAVR 669 Query: 289 ISEEM 303 + EM Sbjct: 670 VLREM 674 >SB_49461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 442 RPFVALFDNYHKNVIRPEFVTPKEETEQNNVHQHYTRHRTY 564 RPFV L + K + + T K+E + + +HY RH Y Sbjct: 217 RPFVVLNKSRRKLPWQADKSTKKDEVPYSELKKHYHRHHWY 257 >SB_9542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.1 bits (62), Expect = 2.7 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Frame = +1 Query: 373 SKNDEA--SSNLLN----VPENVW--SGPTIRPFVALFDNYHKNVIRPEFVTPKEETEQN 528 +K DE S N+ N V N W S T F+ L DNY ++ PEF T + T+Q+ Sbjct: 10 NKRDEPYISLNITNLTTTVTVNTWDLSVKTSLGFIQLIDNYFQDPKGPEFPTKLKNTQQS 69 >SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1512 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 442 RPFVALFDNYHKNVIRPEFVTPKEETEQNNVHQHYTRHRTY 564 RPFV L + K + + T K+E + + +HY RH Y Sbjct: 1470 RPFVVLNKSRRKLPWQADKSTKKDEVPYSELKKHYHRHHWY 1510 >SB_21477| Best HMM Match : 7tm_1 (HMM E-Value=2.7e-06) Length = 348 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 174 CILSRIPLLSSHRIRY*IWKDTVKYLTSRLS-YVIGMT 64 CILS I + S+ + IWKD +K S + YV+G++ Sbjct: 27 CILSAITITSNILLLVAIWKDPLKCFKSAATYYVVGLS 64 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +1 Query: 163 AQNTLQQIGTVVGGVVDYAKKKSYDDMLRQVQ-DSTTDDDLLRISEE 300 A T++++ + V+YAKKKS + Q+ D TT D +RI+E+ Sbjct: 191 AHKTIEELRQQLDRTVEYAKKKSCELNTTQINLDKTTGD--MRITEK 235 >SB_17728| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0032) Length = 1293 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +1 Query: 163 AQNTLQQIGTVVGGVVDYAKKKSYDDMLRQVQ-DSTTDDDLLRISEE 300 A T++++ + V+YAKKKS + Q+ D TT D +RI+E+ Sbjct: 139 AHKTIEELRQQLDRTVEYAKKKSCELNTTQINLDKTTGD--MRITEK 183 >SB_8029| Best HMM Match : Mucin (HMM E-Value=8.6) Length = 325 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 158 IRLRIHCNKSVRLSVASLIMLKRKATMTC 244 +R+ I CN + ++AS I+LK K T++C Sbjct: 90 VRVPIRCNGTNDKTLASCIVLKIKGTLSC 118 >SB_13324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 419 FSGTFSKLDDASSFFDMG 366 F G S+LDDA ++FD+G Sbjct: 323 FRGEMSELDDAGTYFDLG 340 >SB_37609| Best HMM Match : Extensin_2 (HMM E-Value=0.081) Length = 1617 Score = 27.9 bits (59), Expect = 6.2 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +1 Query: 262 STTDDDLLRISEEMFNADINNAFNYIQVSLQGKTSPMSKND-EASSNLLNVPENVWSGPT 438 S + D +E++ N D N A N I S K SP + + E + ++ P+NV P Sbjct: 964 SRSQSDDSSSNEQLPNLD-NTASNGIDASAFVKDSPENVSVIERDTLSVSPPKNVSMSPA 1022 Query: 439 IRPFVALFDNY 471 PF A D Y Sbjct: 1023 PDPFTAQVDPY 1033 >SB_10988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 419 FSGTFSKLDDASSFFDMG 366 F G S+LDDA ++FD+G Sbjct: 187 FRGEMSELDDAGTYFDLG 204 >SB_40536| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00014) Length = 672 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 399 LTKRARERVEWPYNKAVRSAI 461 L KR RE EWP NKA + Sbjct: 584 LPKRTREESEWPENKAAEEDV 604 >SB_48770| Best HMM Match : Peptidase_C1 (HMM E-Value=1.9e-14) Length = 183 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 442 RPFVALFDNYHKNVIRPEFVTPKEETEQNNVHQHYTRHRTY 564 RPFV L + + + T K+E + + +HY RH Y Sbjct: 141 RPFVVLNKSRRNMPWQADKSTKKDEVPYSQLKKHYHRHHWY 181 >SB_25603| Best HMM Match : Ion_trans_2 (HMM E-Value=4.1e-35) Length = 587 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +1 Query: 163 AQNTLQQIGTVVGGVVDYAKKKSYDDMLRQVQDSTTDDDLLRISEEMFNADINN 324 + N L + + +VD DD ++++ +D + ISE NA NN Sbjct: 427 SMNNLMETFGLTARIVDLQDSGEDDDHGNELEELRNNDSCMNISENQDNASKNN 480 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,642,758 Number of Sequences: 59808 Number of extensions: 317880 Number of successful extensions: 1105 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -