BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O22 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 3.0 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 23 5.3 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 7.0 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 24.2 bits (50), Expect = 3.0 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +1 Query: 4 DYTFNPKMRIILILLVSLGLCHADDIAQAAGQIFNSILPNL 126 ++ F+P ++ I + + LC D A Q S P L Sbjct: 889 EFEFDPARTVLEICRIYVNLCECDAFCLAVSQDGRSYSPQL 929 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 23.4 bits (48), Expect = 5.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 1 LDYTFNPKMRIILILLVSLGLC 66 L+Y PK R ++ L+ LG+C Sbjct: 254 LEYVSAPKRRREMMTLIKLGVC 275 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 486 QTRIRHAQRRNRAEQ 530 Q RIRHA RR +A Q Sbjct: 226 QGRIRHADRRYKATQ 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,583 Number of Sequences: 2352 Number of extensions: 9922 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -