BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O22 (570 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61480.1 68418.m07714 leucine-rich repeat transmembrane prote... 31 0.41 At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 31 0.72 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 31 0.72 At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP1... 30 1.2 At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to a... 30 1.2 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 29 1.7 At1g62950.1 68414.m07108 leucine-rich repeat transmembrane prote... 29 2.9 At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-... 28 5.0 At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains... 27 6.7 At1g71240.1 68414.m08222 expressed protein contains Pfam profile... 27 6.7 At5g58100.1 68418.m07270 expressed protein 27 8.8 At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein con... 27 8.8 At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding ... 27 8.8 At3g17490.1 68416.m02234 F-box family protein similar to F-box p... 27 8.8 >At5g61480.1 68418.m07714 leucine-rich repeat transmembrane protein kinase, putative Length = 1041 Score = 31.5 bits (68), Expect = 0.41 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 319 NNAFNYIQVSLQGKTSPMSKNDEASSNLLN--VPENVWSGPTIRPFVALFDN 468 NN F Q+ T+P+ + S+N + +PEN+W P ++ F A F N Sbjct: 450 NNRFTD-QIPADFATAPVLQYLNLSTNFFHRKLPENIWKAPNLQIFSASFSN 500 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 30.7 bits (66), Expect = 0.72 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 259 DSTTDDDLLRISEEMFNADINNAFNYIQ 342 D +T D L +S EMF D NN +Y+Q Sbjct: 633 DLSTVRDALEVSAEMFKKDANNVSDYVQ 660 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 30.7 bits (66), Expect = 0.72 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 259 DSTTDDDLLRISEEMFNADINNAFNYIQ 342 D +T D L +S EMF D NN +Y+Q Sbjct: 633 DLSTVRDALEVSAEMFKKDANNVSDYVQ 660 >At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 968 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/84 (23%), Positives = 34/84 (40%) Frame = +1 Query: 73 DDIAQAAGQIFNSILPNLISNSVTGQQGNTAQNTLQQIGTVVGGVVDYAKKKSYDDMLRQ 252 D+I +A G +FN L L VT QG T T + + V + DD + Sbjct: 757 DEIEKAHGDVFNVFLQILDDGRVTDSQGRTVSFT-NTVIIMTSNVGSQFILNNTDDDANE 815 Query: 253 VQDSTTDDDLLRISEEMFNADINN 324 + T + ++ + +F + N Sbjct: 816 LSYETIKERVMNAARSIFRPEFMN 839 >At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to aldehyde oxidases from Arabidopsis thaliana: GI:3172023, GI:3172025, GI:3172044; identical to cDNA putative aldehyde oxidase (AO2) mRNA, partial cds GI:2792305 Length = 1337 Score = 29.9 bits (64), Expect = 1.2 Identities = 24/92 (26%), Positives = 40/92 (43%) Frame = +1 Query: 40 ILLVSLGLCHADDIAQAAGQIFNSILPNLISNSVTGQQGNTAQNTLQQIGTVVGGVVDYA 219 I + GL AD++ +AGQI ++ + ++ + + IGT V V D Sbjct: 644 ITMFGTGLLFADEVTISAGQIIALVVADTQKHADMAAHLAVVEYDSRNIGTPVLSVEDAV 703 Query: 220 KKKSYDDMLRQVQDSTTDDDLLRISEEMFNAD 315 K+ S ++ + Q D IS+ M AD Sbjct: 704 KRSSLFEVPPEYQPEPVGD----ISKGMAEAD 731 >At5g17760.1 68418.m02082 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 505 Score = 29.5 bits (63), Expect = 1.7 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 6/112 (5%) Frame = +1 Query: 190 TVVGGVVDYAKKKSYDDMLRQV-QDSTTDDDLL--RISEEMFNADINNAF---NYIQVSL 351 ++V + +Y K YD L V +DS LL R + DI+ A N I+ + Sbjct: 268 SLVAAMANYLKFDVYDLQLASVMRDSDLRRLLLATRNRSILVIEDIDCAVDLPNRIEQPV 327 Query: 352 QGKTSPMSKNDEASSNLLNVPENVWSGPTIRPFVALFDNYHKNVIRPEFVTP 507 +GK S+ S LLN + +WS + +F HK+ + P + P Sbjct: 328 EGKNRGESQGPLTLSGLLNFIDGLWSSCGDERII-IFTTNHKDRLDPALLRP 378 >At1g62950.1 68414.m07108 leucine-rich repeat transmembrane protein kinase, putative contains protein kinase domains Length = 890 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 238 DMLRQVQDSTTDDDLLRISEEMFNADINNAFNYIQVSLQG 357 ++L Q +D+ DD ++ + NAD+ N+FN + + +G Sbjct: 34 EILLQFKDNINDDPYNSLASWVSNADLCNSFNGVSCNQEG 73 >At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-13) / HD-ZIP transcription factor 13 identical to homeobox gene 13 protein (GP:12325190) [Arabidopsis thaliana] Length = 294 Score = 27.9 bits (59), Expect = 5.0 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +1 Query: 223 KKSYDDMLRQVQDSTTDDDLLRISEEMFNADINNAFNYIQ---VSLQGKT--SPMSKNDE 387 +K YD + RQ ++DLL+ + A+I N Q ++L +T S +++D Sbjct: 143 EKDYDTLKRQFDTLKAENDLLQTHNQKLQAEIMGLKNREQTESINLNKETEGSCSNRSDN 202 Query: 388 ASSNL 402 +S NL Sbjct: 203 SSDNL 207 >At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains Pfam profile: PF02362 B3 DNA binding domain; identical to cDNA auxin response factor 4 (ARF4) GI:4102597 Length = 788 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 187 GTVVGGVVDYAKKKSYDDMLRQVQDSTTDDDLLRISEE 300 G+ VG +D ++ YDD+L +++ + LLR E+ Sbjct: 674 GSQVGRAIDLSRLNGYDDLLMELERLFNMEGLLRDPEK 711 >At1g71240.1 68414.m08222 expressed protein contains Pfam profile: PF04842 plant protein of unknown function (DUF639) Length = 824 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 185 SVRLSVASLIMLKRKATMTCYVKYRILRRT 274 S L+VA L +++R AT TC KY+++ +T Sbjct: 562 SKHLAVADLTLVER-ATETCRQKYKVVEKT 590 >At5g58100.1 68418.m07270 expressed protein Length = 945 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 145 GQQGNTAQNTLQQIGTVVGGVVDYAKKKSYDDMLRQVQD 261 G +G + +L +GT +G V + ++ ++ D + +QD Sbjct: 409 GGEGVRTELSLPNVGTTIGAVAEISEDEAEDKLQTAIQD 447 >At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 534 Score = 27.1 bits (57), Expect = 8.8 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +1 Query: 385 EASSNLLNVPENVWSGPTIRPFVALFDNYHK-NVIRPEFV--TPKEETEQNNVHQ 540 E LLN +N ++ PTI FD+Y +V R E + T + E QN++ Q Sbjct: 395 EGLRKLLNYIKNKYNNPTIYITENGFDDYENGSVTREEIIEDTKRIEYHQNHLQQ 449 >At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding subunit (ClpC) identical to AtClpC GI:5360574 from [Arabidopsis thaliana]; contains Pfam profiles PF02861: Clp amino terminal domain and PF02151: UvrB/uvrC motif Length = 952 Score = 27.1 bits (57), Expect = 8.8 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = +1 Query: 73 DDIAQAAGQIFNSILPNLISNSVTGQQGNTA--QNTLQQIGTVVG-GVVDYAKKKSYDDM 243 D+I +A +FN +L L +T +G T +NTL + + VG V++ ++ D+ Sbjct: 738 DEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDL 797 Query: 244 LRQVQDSTTDDDLLRISEEM 303 +DS+ + ++EE+ Sbjct: 798 DHDEKDSSYNRIKSLVTEEL 817 >At3g17490.1 68416.m02234 F-box family protein similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains Pfam PF00646: F-box domain and TIGRFAM TIGR01640: F-box protein interaction domain Length = 388 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 186 DLLQCILSRIPLLSSHRIRY 127 DL++ ILSR+P +S R+RY Sbjct: 9 DLVEEILSRVPAISLKRLRY 28 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,460,366 Number of Sequences: 28952 Number of extensions: 212422 Number of successful extensions: 707 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -