BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O19 (367 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 31 0.074 SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharom... 29 0.23 SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosa... 26 2.1 SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 24 6.4 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1596 SPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1655 Query: 284 XP 289 P Sbjct: 1656 SP 1657 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1610 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1669 Query: 284 XP 289 P Sbjct: 1670 SP 1671 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1617 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1676 Query: 284 XP 289 P Sbjct: 1677 SP 1678 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1624 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1683 Query: 284 XP 289 P Sbjct: 1684 SP 1685 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1631 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1690 Query: 284 XP 289 P Sbjct: 1691 SP 1692 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1638 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1697 Query: 284 XP 289 P Sbjct: 1698 SP 1699 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1645 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1704 Query: 284 XP 289 P Sbjct: 1705 SP 1706 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1652 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1711 Query: 284 XP 289 P Sbjct: 1712 SP 1713 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1659 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1718 Query: 284 XP 289 P Sbjct: 1719 SP 1720 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1666 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1725 Query: 284 XP 289 P Sbjct: 1726 SP 1727 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1673 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1732 Query: 284 XP 289 P Sbjct: 1733 SP 1734 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1680 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1739 Query: 284 XP 289 P Sbjct: 1740 SP 1741 Score = 30.7 bits (66), Expect = 0.074 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1687 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1746 Query: 284 XP 289 P Sbjct: 1747 SP 1748 Score = 30.3 bits (65), Expect = 0.098 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1582 SPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1641 Query: 284 XP 289 P Sbjct: 1642 SP 1643 Score = 29.1 bits (62), Expect = 0.23 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1568 SPAYMPSSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSY 1627 Query: 284 XP 289 P Sbjct: 1628 SP 1629 Score = 27.5 bits (58), Expect = 0.69 Identities = 14/62 (22%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+ +P Y P +P Y Sbjct: 1575 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSY 1634 Query: 284 XP 289 P Sbjct: 1635 SP 1636 Score = 27.5 bits (58), Expect = 0.69 Identities = 14/62 (22%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+ +P Y+P +P Y P +P Y Sbjct: 1589 SPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1648 Query: 284 XP 289 P Sbjct: 1649 SP 1650 Score = 27.5 bits (58), Expect = 0.69 Identities = 14/62 (22%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+ +P Y+P +P Y+P +P Y P +P Y Sbjct: 1603 SPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1662 Query: 284 XP 289 P Sbjct: 1663 SP 1664 >SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 29.1 bits (62), Expect = 0.23 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 170 VHVVD-HNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPGQVHVV 307 ++ +D HN + N V V+ N ++ +V+ NPD+ P + VV Sbjct: 537 INAIDVHNSEQNLLAVFVIFRNLSHFEANQNVLVQNPDFFPLLIRVV 583 Score = 25.0 bits (52), Expect = 3.7 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 86 VHVVD-HNPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVV 223 ++ +D HN + N V V+ N + +V+ NPD+ P + VV Sbjct: 537 INAIDVHNSEQNLLAVFVIFRNLSHFEANQNVLVQNPDFFPLLIRVV 583 Score = 25.0 bits (52), Expect = 3.7 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 143 YNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVV 265 +N + N V V+ N + +V+ NPD++P + VV Sbjct: 543 HNSEQNLLAVFVIFRNLSHFEANQNVLVQNPDFFPLLIRVV 583 >SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosaccharomyces pombe|chr 1|||Manual Length = 552 Score = 25.8 bits (54), Expect = 2.1 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = +2 Query: 173 HVVDHNPDYNPGQVHVVD---HNPDYYPGQVH-VVDHNPDYXPGQVHVVDNSGVPSDGNS 340 H + N D +H +D + + +P Q++ + HN DY V G+P G Sbjct: 419 HNSNENGDLITNSLHGLDFLENANESFPEQMYPFIKHNKDYISNHPDEVPPDGLPQKGKH 478 Query: 341 D 343 D Sbjct: 479 D 479 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 24.2 bits (50), Expect = 6.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 366 SGFAITTWSLLPSDGTPLL 310 S F + W++LP G P+L Sbjct: 899 SCFVLRIWNMLPETGVPIL 917 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,574,891 Number of Sequences: 5004 Number of extensions: 33503 Number of successful extensions: 108 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 114084208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -