BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O19 (367 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_1017 + 21747044-21748051 37 0.006 08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969,322... 34 0.039 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 32 0.16 07_03_0380 + 17460078-17460782,17461194-17461252,17461388-174614... 30 0.64 08_01_1010 - 10215625-10216335,10216372-10216473 29 0.85 06_02_0109 - 11919279-11920109 29 1.1 05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287... 29 1.1 03_06_0298 - 32925441-32925998,32926371-32926730,32927161-329272... 28 2.0 09_06_0343 - 22415525-22415833,22415999-22416134,22416593-224166... 28 2.6 12_02_0219 + 15822050-15824896 27 3.4 04_01_0381 - 5061901-5061914,5062044-5062100,5062268-5063231 27 3.4 06_01_0516 - 3722334-3722811,3723712-3724130 27 4.5 03_03_0042 + 14009649-14009866,14011342-14011419,14011791-140119... 27 6.0 01_06_0939 - 33188620-33189252,33189570-33189680,33190460-331906... 27 6.0 >04_03_1017 + 21747044-21748051 Length = 335 Score = 36.7 bits (81), Expect = 0.006 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +PDY+P +PDY P +PDY+P +PDY P +PDY Sbjct: 89 SPDYSPASPPRRAASPDYTPESPPRRAASPDYSPESPPRRAASPDYTPASPSRRAASPDY 148 Query: 284 XP 289 P Sbjct: 149 TP 150 Score = 33.1 bits (72), Expect = 0.069 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +PDY+P +PDY+P +PDY+P +PDY P +PDY Sbjct: 190 SPDYSPSTPPRRAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYTPMSPPRRAASPDY 249 Score = 32.7 bits (71), Expect = 0.091 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +2 Query: 104 NPDYNP-GQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPD 280 +PDY P +PDY+P +PDY+P +PDY P +PD Sbjct: 175 SPDYTPESPPRRRAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYSPSTPPRRAASPD 234 Query: 281 YXP 289 Y P Sbjct: 235 YTP 237 Score = 26.2 bits (55), Expect = 7.9 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 2/69 (2%) Frame = -3 Query: 308 PPREPGL--DXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLRAPGLDYSQGCN*L 135 PPR D S RA D S RA DYS RA DY+ Sbjct: 183 PPRRRAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYSPSTPPRRAASPDYTPMSPPR 242 Query: 134 RAPGLDYNQ 108 RA DY Q Sbjct: 243 RAASPDYTQ 251 >08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969, 3220080-3223195,3223303-3223561,3223665-3223951, 3224029-3224364,3224463-3224604,3224690-3224910, 3224990-3225151,3225242-3225400,3225488-3225787, 3226306-3226569,3227370-3227453 Length = 1855 Score = 33.9 bits (74), Expect = 0.039 Identities = 16/62 (25%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y PG +P Y+P +P Y P +P Y Sbjct: 1568 SPSYSPASPSYSPTSPSYTPGSPTYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1627 Query: 284 XP 289 P Sbjct: 1628 SP 1629 Score = 33.1 bits (72), Expect = 0.069 Identities = 16/62 (25%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y PG +P Y+P +P Y+P +P Y P +P Y Sbjct: 1582 SPSYTPGSPTYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1641 Query: 284 XP 289 P Sbjct: 1642 SP 1643 Score = 30.7 bits (66), Expect = 0.37 Identities = 16/66 (24%), Positives = 23/66 (34%) Frame = +2 Query: 92 VVDHNPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDH 271 V P Y+P +P Y+P +P Y+P +P Y P Sbjct: 1557 VYSPGPGYSPTSPSYSPASPSYSPTSPSYTPGSPTYSPTSPSYSPTSPSYSPTSPSYSPT 1616 Query: 272 NPDYXP 289 +P Y P Sbjct: 1617 SPSYSP 1622 Score = 30.7 bits (66), Expect = 0.37 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1575 SPSYSPTSPSYTPGSPTYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1634 Query: 284 XP 289 P Sbjct: 1635 SP 1636 Score = 30.3 bits (65), Expect = 0.48 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P+Y Sbjct: 1680 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPNY 1739 Query: 284 XP 289 P Sbjct: 1740 SP 1741 Score = 29.9 bits (64), Expect = 0.64 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1666 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGY 1725 Query: 284 XP 289 P Sbjct: 1726 SP 1727 Score = 29.9 bits (64), Expect = 0.64 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P + +P Y Sbjct: 1687 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPNYSPTSPSY 1746 Query: 284 XP 289 P Sbjct: 1747 NP 1748 Score = 29.5 bits (63), Expect = 0.85 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1652 SPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1711 Query: 284 XP 289 P Sbjct: 1712 SP 1713 Score = 29.5 bits (63), Expect = 0.85 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1673 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSY 1732 Query: 284 XP 289 P Sbjct: 1733 SP 1734 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1589 SPTYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPVY 1648 Query: 284 XP 289 P Sbjct: 1649 SP 1650 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1596 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPVYSPTSPAY 1655 Query: 284 XP 289 P Sbjct: 1656 SP 1657 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1659 SPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAY 1718 Query: 284 XP 289 P Sbjct: 1719 SP 1720 Score = 28.7 bits (61), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1610 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPVYSPTSPAYSPTSPAYSPTSPSY 1669 Query: 284 XP 289 P Sbjct: 1670 SP 1671 Score = 28.7 bits (61), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1624 SPSYSPTSPSYSPTSPSYSPTSPVYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSY 1683 Query: 284 XP 289 P Sbjct: 1684 SP 1685 Score = 28.7 bits (61), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1638 SPSYSPTSPVYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1697 Query: 284 XP 289 P Sbjct: 1698 SP 1699 Score = 28.3 bits (60), Expect = 2.0 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1603 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPVYSPTSPAYSPTSPAY 1662 Query: 284 XP 289 P Sbjct: 1663 SP 1664 Score = 28.3 bits (60), Expect = 2.0 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1617 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPVYSPTSPAYSPTSPAYSPTSPSYSPTSPSY 1676 Query: 284 XP 289 P Sbjct: 1677 SP 1678 Score = 28.3 bits (60), Expect = 2.0 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1631 SPSYSPTSPSYSPTSPVYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1690 Query: 284 XP 289 P Sbjct: 1691 SP 1692 Score = 28.3 bits (60), Expect = 2.0 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1645 SPVYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1704 Query: 284 XP 289 P Sbjct: 1705 SP 1706 Score = 27.5 bits (58), Expect = 3.4 Identities = 14/66 (21%), Positives = 24/66 (36%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P+Y P + Y Sbjct: 1694 SPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPNYSPTSPSYNPSSAKY 1753 Query: 284 XPGQVH 301 P + Sbjct: 1754 SPSHAY 1759 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 31.9 bits (69), Expect = 0.16 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYX 286 P Y P P Y P + P+Y+P V P Y P V P+Y Sbjct: 655 PSYEPSPPEYAPEPPVYAPYPPGIFPSPPEYSPEPPSYVPSPPQYAPQPPSYVPSPPEYA 714 Query: 287 P 289 P Sbjct: 715 P 715 Score = 27.5 bits (58), Expect = 3.4 Identities = 16/61 (26%), Positives = 18/61 (29%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYX 286 PD P P Y P P Y P + P+Y P V P Y Sbjct: 641 PDIVPSPPSYEPSPPSYEPSPPEYAPEPPVYAPYPPGIFPSPPEYSPEPPSYVPSPPQYA 700 Query: 287 P 289 P Sbjct: 701 P 701 Score = 27.1 bits (57), Expect = 4.5 Identities = 15/61 (24%), Positives = 16/61 (26%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYX 286 P+Y P Y P P P Y P P Y P P Y Sbjct: 662 PEYAPEPPVYAPYPPGIFPSPPEYSPEPPSYVPSPPQYAPQPPSYVPSPPEYAPEPPVYA 721 Query: 287 P 289 P Sbjct: 722 P 722 Score = 26.6 bits (56), Expect = 6.0 Identities = 16/61 (26%), Positives = 21/61 (34%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYX 286 P Y P + P+Y+P V P Y P V P+Y P + P Sbjct: 669 PVYAPYPPGIFPSPPEYSPEPPSYVPSPPQYAPQPPSYVPSPPEYAPEPPVYAPYPPGIT 728 Query: 287 P 289 P Sbjct: 729 P 729 Score = 26.2 bits (55), Expect = 7.9 Identities = 16/62 (25%), Positives = 20/62 (32%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYX 286 P+Y+P V P Y P V P+Y P + P P P Sbjct: 683 PEYSPEPPSYVPSPPQYAPQPPSYVPSPPEYAPEPPVYAPYPPGITPSPPEYAPEPPPGP 742 Query: 287 PG 292 PG Sbjct: 743 PG 744 >07_03_0380 + 17460078-17460782,17461194-17461252,17461388-17461492, 17461732-17461867,17461919-17461939 Length = 341 Score = 29.9 bits (64), Expect = 0.64 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 239 YYPGQV-HVVDHNPDYXPGQVHVVDNSGVPSDGNSDHVVIA 358 Y PG++ H+V+ P + G+ V + VP DG +H+V++ Sbjct: 275 YAPGRLYHIVERKP-FRCGRYPPVVRTAVPVDGRFEHIVLS 314 >08_01_1010 - 10215625-10216335,10216372-10216473 Length = 270 Score = 29.5 bits (63), Expect = 0.85 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 4/66 (6%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDH--NPDYNPGQVHVVDH--NPDYYPGQVHVVDH 271 +PDY P +PDY P +PDY P +PDY P Sbjct: 70 SPDYTPSTPPRRAASPDYTPSTPTTPRRAASPDYTPSTPTPPRRAASPDYTPSTPPPRAA 129 Query: 272 NPDYXP 289 +PDY P Sbjct: 130 SPDYTP 135 >06_02_0109 - 11919279-11920109 Length = 276 Score = 29.1 bits (62), Expect = 1.1 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 164 GQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDH 271 G + + +PD PG++H +DH Q H +H Sbjct: 68 GALDDISRSPDKKPGELHALDHRISSILQQYHHYNH 103 Score = 27.9 bits (59), Expect = 2.6 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 122 GQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDH 229 G + ++ +PD PG++H +DH Q H +H Sbjct: 68 GALDDISRSPDKKPGELHALDHRISSILQQYHHYNH 103 Score = 26.2 bits (55), Expect = 7.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 206 GQVHVVDHNPDYYPGQVHVVDHNPDYXPGQVH 301 G + + +PD PG++H +DH Q H Sbjct: 68 GALDDISRSPDKKPGELHALDHRISSILQQYH 99 >05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613, 2879715-2879973,2880060-2880346,2880423-2880758, 2880862-2881003,2881077-2881297,2881379-2881540, 2881617-2881775,2881860-2882159,2882834-2883097, 2883133-2883243,2883902-2883988 Length = 1871 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1742 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSSAYSPTSPAYSPTSPGYSPTSPSY 1801 Query: 284 XP 289 P Sbjct: 1802 SP 1803 Score = 27.9 bits (59), Expect = 2.6 Identities = 18/79 (22%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P + Y+P +P Y P +P Y Sbjct: 1749 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSSAYSPTSPAYSPTSPGYSPTSPSYSPSSPSY 1808 Query: 284 XPGQV-HVVDNSGVPSDGN 337 P V + ++ PS N Sbjct: 1809 NPSSVKYTPSHAYSPSSPN 1827 >03_06_0298 - 32925441-32925998,32926371-32926730,32927161-32927230, 32927642-32927797,32929181-32929242,32929339-32929352, 32930421-32930520,32931474-32932574 Length = 806 Score = 28.3 bits (60), Expect = 2.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 240 IIQARCTWLITTLTXIQARFTW 305 ++Q RC W+I +T + R TW Sbjct: 551 VVQTRCRWIIGDVTEVLDRNTW 572 >09_06_0343 - 22415525-22415833,22415999-22416134,22416593-22416697, 22417696-22418291 Length = 381 Score = 27.9 bits (59), Expect = 2.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 239 YYPGQVHVVDHNPDYXPGQVHVVDNSGVPSDGNSDHVVIA 358 Y PG+++ + + G+ V + VP DG +H+V++ Sbjct: 219 YAPGRIYHIVERKMFRCGRYPPVVKTAVPVDGRFEHIVLS 258 >12_02_0219 + 15822050-15824896 Length = 948 Score = 27.5 bits (58), Expect = 3.4 Identities = 10/39 (25%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 6 DNSDTIRQ*KLSC-FSSSPYWPWLPQTECTWSIITLIII 119 D D +R+ ++ C F+ P WPWL +++ +++ Sbjct: 269 DFGDPLRKHEMHCRFTQGPPWPWLAVASSYGTLVISLLV 307 >04_01_0381 - 5061901-5061914,5062044-5062100,5062268-5063231 Length = 344 Score = 27.5 bits (58), Expect = 3.4 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = -3 Query: 296 PGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLRAPGLDYSQGCN*LRAPGL 120 PGL Q + PGL ++ PGL Q ++ PGL Q ++ PGL Sbjct: 127 PGLPTLQPLPTIQIPGLPPLPQLPTIQIPGLPPLQPLPAIQIPGLPPLQPLPTIQIPGL 185 >06_01_0516 - 3722334-3722811,3723712-3724130 Length = 298 Score = 27.1 bits (57), Expect = 4.5 Identities = 15/57 (26%), Positives = 23/57 (40%) Frame = +2 Query: 110 DYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPD 280 D + G + N N + GQ+H V + PG H+ P V++N D Sbjct: 193 DDDDGHHEINNNNNNLGGGQLHAVVGAVGHGPGAGHIAPATPSNNNTAAAAVNNNVD 249 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +2 Query: 98 DHNPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPD 238 ++N + GQ+H V + PG H+ P N V++N D Sbjct: 203 NNNNNLGGGQLHAVVGAVGHGPGAGHIAPATPSNNNTAAAAVNNNVD 249 >03_03_0042 + 14009649-14009866,14011342-14011419,14011791-14011955, 14012071-14012138,14012219-14012258,14013579-14013690, 14013859-14013942 Length = 254 Score = 26.6 bits (56), Expect = 6.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 140 NYNPDYNPGQVHVVDHNPDYNPGQ 211 +Y+P +P + DH DY+PG+ Sbjct: 177 SYSPSPSPARRDYRDHRDDYSPGE 200 >01_06_0939 - 33188620-33189252,33189570-33189680,33190460-33190668, 33190781-33191078 Length = 416 Score = 26.6 bits (56), Expect = 6.0 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 338 YCRPMEHHYCPPREPGLDXSQGCDQPRAPGLDNS 237 YC P+ P R PG+D S +P APG S Sbjct: 43 YCSPVTARLLPTRFPGVDAS--LLRPLAPGASAS 74 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,906,175 Number of Sequences: 37544 Number of extensions: 236186 Number of successful extensions: 734 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 564709324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -