BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O19 (367 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK125752-1|BAC86274.1| 122|Homo sapiens protein ( Homo sapiens ... 40 0.002 X74874-1|CAA52862.1| 1970|Homo sapiens RNA polymerase II largest... 36 0.040 X63564-1|CAA45125.1| 1970|Homo sapiens RNA polymerase II largest... 36 0.040 D89501-1|BAA13971.1| 134|Homo sapiens PBI protein. 35 0.092 BT006656-1|AAP35302.1| 343|Homo sapiens carbonic anhydrase XII ... 33 0.28 BC023981-1|AAH23981.1| 354|Homo sapiens carbonic anhydrase XII ... 33 0.28 BC011691-1|AAH11691.1| 343|Homo sapiens carbonic anhydrase XII ... 33 0.28 BC000278-1|AAH00278.1| 343|Homo sapiens carbonic anhydrase XII ... 33 0.28 AF051882-1|AAC39789.1| 354|Homo sapiens carbonic anhydrase XII ... 33 0.28 AF037335-1|AAC63952.1| 354|Homo sapiens carbonic anhydrase prec... 33 0.28 AK130129-1|BAC85294.1| 370|Homo sapiens protein. 32 0.49 M84739-1|AAA51916.1| 417|Homo sapiens calreticulin protein. 31 0.86 M32294-1|AAA36582.1| 417|Homo sapiens protein ( Human Ro ribonu... 31 0.86 CR457070-1|CAG33351.1| 417|Homo sapiens CALR protein. 31 0.86 BT007448-1|AAP36116.1| 417|Homo sapiens calreticulin protein. 31 0.86 BC020493-1|AAH20493.1| 417|Homo sapiens calreticulin protein. 31 0.86 BC007911-1|AAH07911.1| 417|Homo sapiens calreticulin protein. 31 0.86 BC002500-1|AAH02500.1| 417|Homo sapiens calreticulin protein. 31 0.86 AY047586-1|AAL13126.1| 417|Homo sapiens calreticulin protein. 31 0.86 AK223060-1|BAD96780.1| 406|Homo sapiens calreticulin precursor ... 31 0.86 AD000092-6|AAB51176.1| 417|Homo sapiens calreticulin protein. 31 0.86 AY515311-1|AAS87212.1| 924|Homo sapiens sONE protein. 31 1.5 AK096734-1|BAC04853.1| 340|Homo sapiens protein ( Homo sapiens ... 31 1.5 BC126108-1|AAI26109.1| 957|Homo sapiens collagen, type XXI, alp... 30 2.6 AL513530-3|CAH73912.1| 954|Homo sapiens collagen type XXI alpha... 30 2.6 AL513530-2|CAH73913.1| 957|Homo sapiens collagen type XXI alpha... 30 2.6 AL034452-2|CAI22396.1| 954|Homo sapiens collagen type XXI alpha... 30 2.6 AL034452-1|CAI22395.1| 957|Homo sapiens collagen type XXI alpha... 30 2.6 AL031782-4|CAI22497.1| 954|Homo sapiens collagen type XXI alpha... 30 2.6 AL031782-3|CAI22496.1| 957|Homo sapiens collagen type XXI alpha... 30 2.6 AF438327-1|AAL86699.1| 957|Homo sapiens alpha 1 type XXI collag... 30 2.6 AF414088-1|AAL02227.1| 957|Homo sapiens collagen XXI protein. 30 2.6 AF330693-1|AAL50033.1| 954|Homo sapiens alpha 1 chain-like coll... 30 2.6 Y12434-1|CAC79625.2| 608|Homo sapiens UDP-GalNAc:polypeptide N-... 29 6.0 AK025287-1|BAB15105.1| 608|Homo sapiens protein ( Homo sapiens ... 29 6.0 AC006017-2|AAD45821.1| 608|Homo sapiens WUGSC:H_DJ0981O07.2 pro... 29 6.0 AK124693-1|BAC85927.1| 206|Homo sapiens protein ( Homo sapiens ... 28 8.0 >AK125752-1|BAC86274.1| 122|Homo sapiens protein ( Homo sapiens cDNA FLJ43764 fis, clone TESTI2048898. ). Length = 122 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/74 (31%), Positives = 35/74 (47%) Frame = -1 Query: 310 VHHVNLAWXIVRVVINHVHLAWIIVRVMIDYVHLAWIIVRVVIDYVHLAWIIVRVVIDYV 131 V HV L W V + V L W++V + V L W+ V + V L W++V + V Sbjct: 7 VGHVVLWWMPVIATVGCVVLWWMLVIAAVGRVVLWWMPVIAAVGCVVLWWMLVIATVGRV 66 Query: 130 HLAWIIIRVMIDHV 89 L W+ + + HV Sbjct: 67 VLWWMPVIAAVGHV 80 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/65 (30%), Positives = 33/65 (50%) Frame = -1 Query: 301 VNLAWXIVRVVINHVHLAWIIVRVMIDYVHLAWIIVRVVIDYVHLAWIIVRVVIDYVHLA 122 V L W +V + V L W+ V + V L W++V + V L W+ V + +V L Sbjct: 24 VVLWWMLVIAAVGRVVLWWMPVIAAVGCVVLWWMLVIATVGRVVLWWMPVIAAVGHVVLW 83 Query: 121 WIIIR 107 W++I+ Sbjct: 84 WVLIQ 88 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = -1 Query: 280 VRVVINHVHLAWIIVRVMIDYVHLAWIIVRVVIDYVHLAWIIVRVVIDYVHLAWIIIRVM 101 V + HV L W+ V + V L W++V + V L W+ V + V L W+++ Sbjct: 3 VIAAVGHVVLWWMPVIATVGCVVLWWMLVIAAVGRVVLWWMPVIAAVGCVVLWWMLVIAT 62 Query: 100 IDHV 89 + V Sbjct: 63 VGRV 66 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -1 Query: 310 VHHVNLAWXIVRVVINHVHLAWIIVRVMIDYVHLAWIIVRVVIDYVHLAWIIVR 149 V V L W V + V L W++V + V L W+ V + +V L W++++ Sbjct: 35 VGRVVLWWMPVIAAVGCVVLWWMLVIATVGRVVLWWMPVIAAVGHVVLWWVLIQ 88 >X74874-1|CAA52862.1| 1970|Homo sapiens RNA polymerase II largest subunit protein. Length = 1970 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y P +P Y+P +P Y P +P Y Sbjct: 1801 SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY 1860 Query: 284 XP 289 P Sbjct: 1861 SP 1862 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y P + +P Y+P +P Y+P +P Y P +P Y Sbjct: 1773 SPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSY 1832 Query: 284 XP 289 P Sbjct: 1833 SP 1834 Score = 34.7 bits (76), Expect = 0.092 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y P +P Y P +P Y Sbjct: 1787 SPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSY 1846 Query: 284 XP 289 P Sbjct: 1847 SP 1848 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P+Y+P + +P Y+P +P+Y P + +P Y Sbjct: 1731 SPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSY 1790 Query: 284 XP 289 P Sbjct: 1791 SP 1792 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P+Y P + +P Y+P +P Y P +P Y Sbjct: 1759 SPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTY 1818 Query: 284 XP 289 P Sbjct: 1819 TP 1820 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P + +P+Y P +P Y P + +P+Y Sbjct: 1724 SPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNY 1783 Query: 284 XP 289 P Sbjct: 1784 SP 1785 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P + +P+Y P +P Y+P + +P+Y P +P Y Sbjct: 1738 SPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSY 1797 Query: 284 XP 289 P Sbjct: 1798 SP 1799 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y+P + +P Y+P +P+Y P + +P Y P +P Y Sbjct: 1745 SPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSY 1804 Query: 284 XP 289 P Sbjct: 1805 SP 1806 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P+Y+P + +P Y P +P+Y Sbjct: 1717 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNY 1776 Query: 284 XP 289 P Sbjct: 1777 TP 1778 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P + +P+Y+P +P Y+P +P Y P +P Y Sbjct: 1766 SPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSY 1825 Query: 284 XP 289 P Sbjct: 1826 SP 1827 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P+Y P + +P Y Sbjct: 1703 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSY 1762 Query: 284 XP 289 P Sbjct: 1763 SP 1764 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1815 SPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKY 1874 Query: 284 XP 289 P Sbjct: 1875 SP 1876 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y P +P Y+P + +P+Y+P +P Y P +P Y Sbjct: 1752 SPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRY 1811 Query: 284 XP 289 P Sbjct: 1812 TP 1813 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P + +P+Y Sbjct: 1696 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNY 1755 Query: 284 XP 289 P Sbjct: 1756 TP 1757 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P + +P+Y P +P Y Sbjct: 1710 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSY 1769 Query: 284 XP 289 P Sbjct: 1770 SP 1771 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y P +P Y+P +P Y P +P+Y Sbjct: 1794 SPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEY 1853 Query: 284 XP 289 P Sbjct: 1854 TP 1855 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P + +P Y+P +P Y P +P Y Sbjct: 1612 SPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1671 Query: 284 XP 289 P Sbjct: 1672 SP 1673 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P + +P Y+P +P Y+P +P Y P +P Y Sbjct: 1626 SPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1685 Query: 284 XP 289 P Sbjct: 1686 SP 1687 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y+P +P Y+P +P Y P +P Y P +P Y Sbjct: 1780 SPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKY 1839 Query: 284 XP 289 P Sbjct: 1840 TP 1841 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P P Y Sbjct: 1829 SPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKY 1888 Query: 284 XP 289 P Sbjct: 1889 SP 1890 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P+Y+P +P Y+P +P Y P +P Y Sbjct: 1619 SPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1678 Query: 284 XP 289 P Sbjct: 1679 SP 1680 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1633 SPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1692 Query: 284 XP 289 P Sbjct: 1693 SP 1694 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P+Y Sbjct: 1689 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNY 1748 Query: 284 XP 289 P Sbjct: 1749 SP 1750 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1640 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1699 Query: 284 XP 289 P Sbjct: 1700 SP 1701 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1647 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1706 Query: 284 XP 289 P Sbjct: 1707 SP 1708 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1654 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1713 Query: 284 XP 289 P Sbjct: 1714 SP 1715 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1661 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1720 Query: 284 XP 289 P Sbjct: 1721 SP 1722 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1668 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1727 Query: 284 XP 289 P Sbjct: 1728 SP 1729 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1675 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1734 Query: 284 XP 289 P Sbjct: 1735 SP 1736 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1682 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1741 Query: 284 XP 289 P Sbjct: 1742 SP 1743 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y P +P Y+P +P Y P +P+Y P +P Y Sbjct: 1808 SPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKY 1867 Query: 284 XP 289 P Sbjct: 1868 SP 1869 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y P +P+Y P +P Y P +P Y Sbjct: 1822 SPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTY 1881 Query: 284 XP 289 P Sbjct: 1882 SP 1883 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P P Y P +P Y Sbjct: 1843 SPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVY 1902 Query: 284 XP 289 P Sbjct: 1903 TP 1904 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1850 SPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKY 1909 Query: 284 XP 289 P Sbjct: 1910 SP 1911 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y P +P+Y P +P Y+P +P Y P +P Y Sbjct: 1836 SPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTY 1895 Query: 284 XP 289 P Sbjct: 1896 SP 1897 >X63564-1|CAA45125.1| 1970|Homo sapiens RNA polymerase II largest subunit protein. Length = 1970 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y P +P Y+P +P Y P +P Y Sbjct: 1801 SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY 1860 Query: 284 XP 289 P Sbjct: 1861 SP 1862 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y P + +P Y+P +P Y+P +P Y P +P Y Sbjct: 1773 SPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSY 1832 Query: 284 XP 289 P Sbjct: 1833 SP 1834 Score = 34.7 bits (76), Expect = 0.092 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y P +P Y P +P Y Sbjct: 1787 SPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSY 1846 Query: 284 XP 289 P Sbjct: 1847 SP 1848 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P+Y+P + +P Y+P +P+Y P + +P Y Sbjct: 1731 SPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSY 1790 Query: 284 XP 289 P Sbjct: 1791 SP 1792 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P+Y P + +P Y+P +P Y P +P Y Sbjct: 1759 SPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTY 1818 Query: 284 XP 289 P Sbjct: 1819 TP 1820 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P + +P+Y P +P Y P + +P+Y Sbjct: 1724 SPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNY 1783 Query: 284 XP 289 P Sbjct: 1784 SP 1785 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P + +P+Y P +P Y+P + +P+Y P +P Y Sbjct: 1738 SPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSY 1797 Query: 284 XP 289 P Sbjct: 1798 SP 1799 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y+P + +P Y+P +P+Y P + +P Y P +P Y Sbjct: 1745 SPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSY 1804 Query: 284 XP 289 P Sbjct: 1805 SP 1806 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P+Y+P + +P Y P +P+Y Sbjct: 1717 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNY 1776 Query: 284 XP 289 P Sbjct: 1777 TP 1778 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P + +P+Y+P +P Y+P +P Y P +P Y Sbjct: 1766 SPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSY 1825 Query: 284 XP 289 P Sbjct: 1826 SP 1827 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P+Y P + +P Y Sbjct: 1703 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSY 1762 Query: 284 XP 289 P Sbjct: 1763 SP 1764 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1815 SPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKY 1874 Query: 284 XP 289 P Sbjct: 1875 SP 1876 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y P +P Y+P + +P+Y+P +P Y P +P Y Sbjct: 1752 SPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRY 1811 Query: 284 XP 289 P Sbjct: 1812 TP 1813 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P + +P+Y Sbjct: 1696 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNY 1755 Query: 284 XP 289 P Sbjct: 1756 TP 1757 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/62 (24%), Positives = 25/62 (40%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P + +P+Y P +P Y Sbjct: 1710 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSY 1769 Query: 284 XP 289 P Sbjct: 1770 SP 1771 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y P +P Y+P +P Y P +P+Y Sbjct: 1794 SPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEY 1853 Query: 284 XP 289 P Sbjct: 1854 TP 1855 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P + +P Y+P +P Y P +P Y Sbjct: 1612 SPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1671 Query: 284 XP 289 P Sbjct: 1672 SP 1673 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P + +P Y+P +P Y+P +P Y P +P Y Sbjct: 1626 SPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1685 Query: 284 XP 289 P Sbjct: 1686 SP 1687 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y+P +P Y+P +P Y P +P Y P +P Y Sbjct: 1780 SPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKY 1839 Query: 284 XP 289 P Sbjct: 1840 TP 1841 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P P Y Sbjct: 1829 SPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKY 1888 Query: 284 XP 289 P Sbjct: 1889 SP 1890 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P+Y+P +P Y+P +P Y P +P Y Sbjct: 1619 SPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1678 Query: 284 XP 289 P Sbjct: 1679 SP 1680 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1633 SPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1692 Query: 284 XP 289 P Sbjct: 1693 SP 1694 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P+Y Sbjct: 1689 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNY 1748 Query: 284 XP 289 P Sbjct: 1749 SP 1750 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1640 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1699 Query: 284 XP 289 P Sbjct: 1700 SP 1701 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1647 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1706 Query: 284 XP 289 P Sbjct: 1707 SP 1708 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1654 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1713 Query: 284 XP 289 P Sbjct: 1714 SP 1715 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1661 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1720 Query: 284 XP 289 P Sbjct: 1721 SP 1722 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1668 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1727 Query: 284 XP 289 P Sbjct: 1728 SP 1729 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1675 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1734 Query: 284 XP 289 P Sbjct: 1735 SP 1736 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1682 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1741 Query: 284 XP 289 P Sbjct: 1742 SP 1743 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y P +P Y+P +P Y P +P+Y P +P Y Sbjct: 1808 SPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKY 1867 Query: 284 XP 289 P Sbjct: 1868 SP 1869 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y P +P+Y P +P Y P +P Y Sbjct: 1822 SPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTY 1881 Query: 284 XP 289 P Sbjct: 1882 SP 1883 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y+P +P Y+P +P Y+P P Y P +P Y Sbjct: 1843 SPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVY 1902 Query: 284 XP 289 P Sbjct: 1903 TP 1904 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/62 (24%), Positives = 23/62 (37%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P+Y P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1850 SPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKY 1909 Query: 284 XP 289 P Sbjct: 1910 SP 1911 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/62 (24%), Positives = 22/62 (35%) Frame = +2 Query: 104 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 283 +P Y P +P+Y P +P Y+P +P Y P +P Y Sbjct: 1836 SPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTY 1895 Query: 284 XP 289 P Sbjct: 1896 SP 1897 >D89501-1|BAA13971.1| 134|Homo sapiens PBI protein. Length = 134 Score = 34.7 bits (76), Expect = 0.092 Identities = 24/77 (31%), Positives = 31/77 (40%) Frame = +2 Query: 101 HNPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPD 280 H P Y PG+ +P Y PG++ P Y PG++ P Y PG Sbjct: 54 HPPPYGPGRFPPP-LSPPYGPGRIPP-SPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRP 111 Query: 281 YXPGQVHVVDNSGVPSD 331 Y PG NS P+D Sbjct: 112 YPPGPPFFPVNS--PTD 126 >BT006656-1|AAP35302.1| 343|Homo sapiens carbonic anhydrase XII protein. Length = 343 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +2 Query: 119 PGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXP 289 P +H+ Y+ Q+H+ NP+ G H V + ++ ++H+V +N D P Sbjct: 101 PSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTV--SGQHFAAELHIVHYNSDLYP 155 >BC023981-1|AAH23981.1| 354|Homo sapiens carbonic anhydrase XII protein. Length = 354 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +2 Query: 119 PGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXP 289 P +H+ Y+ Q+H+ NP+ G H V + ++ ++H+V +N D P Sbjct: 101 PSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTV--SGQHFAAELHIVHYNSDLYP 155 >BC011691-1|AAH11691.1| 343|Homo sapiens carbonic anhydrase XII protein. Length = 343 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +2 Query: 119 PGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXP 289 P +H+ Y+ Q+H+ NP+ G H V + ++ ++H+V +N D P Sbjct: 101 PSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTV--SGQHFAAELHIVHYNSDLYP 155 >BC000278-1|AAH00278.1| 343|Homo sapiens carbonic anhydrase XII protein. Length = 343 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +2 Query: 119 PGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXP 289 P +H+ Y+ Q+H+ NP+ G H V + ++ ++H+V +N D P Sbjct: 101 PSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTV--SGQHFAAELHIVHYNSDLYP 155 >AF051882-1|AAC39789.1| 354|Homo sapiens carbonic anhydrase XII precursor protein. Length = 354 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +2 Query: 119 PGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXP 289 P +H+ Y+ Q+H+ NP+ G H V + ++ ++H+V +N D P Sbjct: 101 PSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTV--SGQHFAAELHIVHYNSDLYP 155 >AF037335-1|AAC63952.1| 354|Homo sapiens carbonic anhydrase precursor protein. Length = 354 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +2 Query: 119 PGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXP 289 P +H+ Y+ Q+H+ NP+ G H V + ++ ++H+V +N D P Sbjct: 101 PSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTV--SGQHFAAELHIVHYNSDLYP 155 >AK130129-1|BAC85294.1| 370|Homo sapiens protein. Length = 370 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/70 (24%), Positives = 28/70 (40%) Frame = -3 Query: 329 PMEHHYCPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLRAPGLDYSQ 150 P + H P PG+ + PR PG+ + R PG+ + R PG+ + Sbjct: 257 PTQTHGISPTTPGVPRRRTASAPRTPGVPRRRTASAPRTPGVPRRRRASAPRTPGVPRRR 316 Query: 149 GCN*LRAPGL 120 + PG+ Sbjct: 317 RASAPWVPGI 326 Score = 32.3 bits (70), Expect = 0.49 Identities = 22/80 (27%), Positives = 32/80 (40%), Gaps = 1/80 (1%) Frame = -3 Query: 305 PREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLRAPGLDYSQGCN*LRAP 126 PR PG+ + PR PG+ + R PG+ + PG+ S R P Sbjct: 279 PRTPGVPRRRTASAPRTPGVPRRRRASAPRTPGVPRRRRASAPWVPGIPPSCEAPASRMP 338 Query: 125 GLDYNQGYDRPR-ALCLRQP 69 + + G+ R A C QP Sbjct: 339 RVPPDTGHGHHRDAWCPTQP 358 >M84739-1|AAA51916.1| 417|Homo sapiens calreticulin protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >M32294-1|AAA36582.1| 417|Homo sapiens protein ( Human Ro ribonucleoprotein autoantigen (Ro/SS-A), complete cds. ). Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >CR457070-1|CAG33351.1| 417|Homo sapiens CALR protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >BT007448-1|AAP36116.1| 417|Homo sapiens calreticulin protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >BC020493-1|AAH20493.1| 417|Homo sapiens calreticulin protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >BC007911-1|AAH07911.1| 417|Homo sapiens calreticulin protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >BC002500-1|AAH02500.1| 417|Homo sapiens calreticulin protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >AY047586-1|AAL13126.1| 417|Homo sapiens calreticulin protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >AK223060-1|BAD96780.1| 406|Homo sapiens calreticulin precursor variant protein. Length = 406 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 249 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 302 >AD000092-6|AAB51176.1| 417|Homo sapiens calreticulin protein. Length = 417 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 152 DYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYXPG-QVHVVDNSGV 322 ++ P + ++ ++ P Q+ NPDY +H NP+Y P ++ DN GV Sbjct: 260 EWEPPVIQNPEYKGEWKPRQID----NPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGV 313 >AY515311-1|AAS87212.1| 924|Homo sapiens sONE protein. Length = 924 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 225 IITLTIIQARCTWLITTLTXIQARFTWWTIVVFHRTAI 338 ++ L ++ A WL+ L + F++W I VF+R A+ Sbjct: 280 LLVLLLVLAAGFWLVQLLRSVCNLFSYWDIQVFYREAL 317 >AK096734-1|BAC04853.1| 340|Homo sapiens protein ( Homo sapiens cDNA FLJ39415 fis, clone PLACE6016160. ). Length = 340 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 225 IITLTIIQARCTWLITTLTXIQARFTWWTIVVFHRTAI 338 ++ L ++ A WL+ L + F++W I VF+R A+ Sbjct: 280 LLVLLLVLAAGFWLVQLLRSVCNLFSYWDIQVFYREAL 317 >BC126108-1|AAI26109.1| 957|Homo sapiens collagen, type XXI, alpha 1 protein. Length = 957 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 446 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 498 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 499 RGLPGYKGEPGRD 511 >AL513530-3|CAH73912.1| 954|Homo sapiens collagen type XXI alpha 1 protein. Length = 954 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 443 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 495 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 496 RGLPGYKGEPGRD 508 >AL513530-2|CAH73913.1| 957|Homo sapiens collagen type XXI alpha 1 protein. Length = 957 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 446 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 498 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 499 RGLPGYKGEPGRD 511 >AL034452-2|CAI22396.1| 954|Homo sapiens collagen type XXI alpha 1 protein. Length = 954 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 443 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 495 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 496 RGLPGYKGEPGRD 508 >AL034452-1|CAI22395.1| 957|Homo sapiens collagen type XXI alpha 1 protein. Length = 957 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 446 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 498 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 499 RGLPGYKGEPGRD 511 >AL031782-4|CAI22497.1| 954|Homo sapiens collagen type XXI alpha 1 protein. Length = 954 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 443 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 495 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 496 RGLPGYKGEPGRD 508 >AL031782-3|CAI22496.1| 957|Homo sapiens collagen type XXI alpha 1 protein. Length = 957 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 446 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 498 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 499 RGLPGYKGEPGRD 511 >AF438327-1|AAL86699.1| 957|Homo sapiens alpha 1 type XXI collagen precursor protein. Length = 957 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 446 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 498 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 499 RGLPGYKGEPGRD 511 >AF414088-1|AAL02227.1| 957|Homo sapiens collagen XXI protein. Length = 957 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 446 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 498 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 499 RGLPGYKGEPGRD 511 >AF330693-1|AAL50033.1| 954|Homo sapiens alpha 1 chain-like collagen COLA1L precursor protein. Length = 954 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -3 Query: 311 CPPREPGLDXSQGCDQPRAPGLDNSQGYDRLRAPGLDYSQGCDRLR-APGLDYSQGCN*L 135 CPP +PGL +G PGL + GY PG D G + PG+ S G Sbjct: 443 CPPGKPGLQGPKG-----DPGLPGNPGYP--GQPGQDGKPGYQGIAGTPGVPGSPGIQGA 495 Query: 134 RA-PGLDYNQGYD 99 R PG G D Sbjct: 496 RGLPGYKGEPGRD 508 >Y12434-1|CAC79625.2| 608|Homo sapiens UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase protein. Length = 608 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNP--GQVH-VVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNP 277 PD V + YN ++ VH V+D P + ++ +VD + D+ + + ++ Sbjct: 148 PDLPAASVVICFYNEAFSALLRTVHSVIDRTPAHLLHEIILVDDDSDFDDLKGELDEYVQ 207 Query: 278 DYXPGQVHVVDNS 316 Y PG++ V+ N+ Sbjct: 208 KYLPGKIKVIRNT 220 >AK025287-1|BAB15105.1| 608|Homo sapiens protein ( Homo sapiens cDNA: FLJ21634 fis, clone COL08230. ). Length = 608 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNP--GQVH-VVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNP 277 PD V + YN ++ VH V+D P + ++ +VD + D+ + + ++ Sbjct: 148 PDLPAASVVICFYNEAFSALLRTVHSVIDRTPAHLLHEIILVDDDSDFDDLKGELDEYVQ 207 Query: 278 DYXPGQVHVVDNS 316 Y PG++ V+ N+ Sbjct: 208 KYLPGKIKVIRNT 220 >AC006017-2|AAD45821.1| 608|Homo sapiens WUGSC:H_DJ0981O07.2 protein. Length = 608 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = +2 Query: 107 PDYNPGQVHVVNYNPDYNP--GQVH-VVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNP 277 PD V + YN ++ VH V+D P + ++ +VD + D+ + + ++ Sbjct: 148 PDLPAASVVICFYNEAFSALLRTVHSVIDRTPAHLLHEIILVDDDSDFDDLKGELDEYVQ 207 Query: 278 DYXPGQVHVVDNS 316 Y PG++ V+ N+ Sbjct: 208 KYLPGKIKVIRNT 220 >AK124693-1|BAC85927.1| 206|Homo sapiens protein ( Homo sapiens cDNA FLJ42703 fis, clone BRAMY3005932, moderately similar to Diacylglycerol kinase, zeta (EC 2.7.1.107). ). Length = 206 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 350 LRGHYCRPMEHHYCP 306 L GH C P+ H YCP Sbjct: 88 LPGHICHPLGHPYCP 102 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,118,606 Number of Sequences: 237096 Number of extensions: 1419744 Number of successful extensions: 3715 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 2918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3618 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2306171440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -