BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O16 (299 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0246 - 16393943-16394410 27 2.1 10_08_0838 - 20927020-20927207,20927288-20927491,20927654-209282... 27 2.1 10_02_0197 + 6596197-6596402,6596766-6596828,6599679-6599795,660... 27 3.6 06_03_0420 + 20593468-20593719,20594534-20594581,20595155-20595970 27 3.6 04_04_0181 - 23363893-23364458,23364548-23364626,23364749-233648... 27 3.6 08_01_0911 - 8976912-8977127,8977743-8977867,8977937-8978058,897... 26 6.3 09_04_0217 + 15739279-15739365,15739460-15739621,15739726-157397... 25 8.3 08_02_0550 + 18509365-18509589,18509668-18510644,18510828-185118... 25 8.3 08_01_0182 - 1534448-1534557,1534925-1535987 25 8.3 06_02_0303 + 14022428-14022652,14023247-14024159,14024310-140247... 25 8.3 06_02_0014 + 10585888-10586422,10586621-10586652,10587127-10587216 25 8.3 04_04_1093 + 30825722-30826168,30826457-30826608,30826926-308270... 25 8.3 01_01_0908 + 7158172-7158356,7159436-7159866,7159953-7161061,716... 25 8.3 >12_02_0246 - 16393943-16394410 Length = 155 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 23 QDGTRGNCYGRDQRLEGKTPNSITAVTIHIQD 118 QDG N + RL+G TP S+ A + + D Sbjct: 23 QDGLAPNGVHQGHRLDGSTPESLHAAGVRVGD 54 >10_08_0838 - 20927020-20927207,20927288-20927491,20927654-20928297, 20928549-20928788,20928884-20928978,20929087-20929434, 20929824-20930042,20930422-20930487,20931191-20931362, 20931456-20931703,20931933-20932073,20932238-20932330, 20932421-20932471,20933571-20933693,20933793-20934035, 20934131-20934211,20935245-20935340,20935535-20936320, 20936443-20937012,20937322-20937427,20938102-20938206, 20938311-20938432,20939321-20939413,20940081-20940104 Length = 1685 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 8 SRLSSQDGTRGNCYGRDQRLEGKTPNSITAVTIHIQ 115 S +S Q G GNC + G T +S+ + H+Q Sbjct: 1409 SEVSLQSGDHGNCIAQATEALGVTSSSVDSFFAHLQ 1444 >10_02_0197 + 6596197-6596402,6596766-6596828,6599679-6599795, 6600311-6600545,6600771-6600929,6601159-6601310, 6602511-6602571 Length = 330 Score = 26.6 bits (56), Expect = 3.6 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 159 LRFPRGKWRGVQDRSWMWI-VTAVIEFGVFPSSL 61 L F RGKWR + R++ WI A I + V P SL Sbjct: 65 LIFERGKWRDMDWRAFGWIFFNAFIGYAV-PMSL 97 >06_03_0420 + 20593468-20593719,20594534-20594581,20595155-20595970 Length = 371 Score = 26.6 bits (56), Expect = 3.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 67 GRKNSKFYYSSYNPHPRPILNTSPFSS 147 GR S SSY P PR N SP SS Sbjct: 114 GRSASPSPCSSYQPSPRASYNPSPASS 140 >04_04_0181 - 23363893-23364458,23364548-23364626,23364749-23364818, 23367534-23367538 Length = 239 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 94 SSYNPHPRPILNTSPFSSRETKNVRR*H 177 +SY+ HP P +SP + T +V R H Sbjct: 171 ASYSAHPSPCYRSSPLAGGYTLDVARSH 198 >08_01_0911 - 8976912-8977127,8977743-8977867,8977937-8978058, 8978283-8978422 Length = 200 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 183 TAVLSSHVLRFPRGKWRGVQDRSWMWIVTAV 91 T++LS+H RG GV+ RS W++ +V Sbjct: 136 TSLLSAHGSSHSRGFLGGVECRSGFWVMWSV 166 >09_04_0217 + 15739279-15739365,15739460-15739621,15739726-15739794, 15740143-15740275,15740873-15741105,15741462-15741526, 15743252-15743327,15744076-15744144,15744233-15744409, 15745349-15745633 Length = 451 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 180 RSAYEQRDDLSIINGLN*TIYHDTNLFLY 266 RSA E+ D+L + LN HD +LF Y Sbjct: 209 RSAKEEADELLMEAALNNNQVHDVSLFDY 237 >08_02_0550 + 18509365-18509589,18509668-18510644,18510828-18511802, 18511885-18512142,18512216-18512326,18512418-18512496, 18512595-18512687,18512773-18512958 Length = 967 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 52 SRSKAGRKNSKFYYSSYNPHPRP 120 S S +G S Y+S +PHP P Sbjct: 30 SSSSSGEAGSDSYHSPSDPHPSP 52 >08_01_0182 - 1534448-1534557,1534925-1535987 Length = 390 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 207 GRLVVHTLTAVLSSHVLRFPRGKWR 133 G+ VV+ LTA HVLR P G R Sbjct: 191 GKKVVYCLTAGGDVHVLRLPAGGQR 215 >06_02_0303 + 14022428-14022652,14023247-14024159,14024310-14024700, 14024949-14025206,14025284-14025394,14025486-14025564, 14025842-14026027 Length = 720 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 52 SRSKAGRKNSKFYYSSYNPHPRP 120 S S +G S Y+S +PHP P Sbjct: 30 SSSSSGEAGSDSYHSPSDPHPSP 52 >06_02_0014 + 10585888-10586422,10586621-10586652,10587127-10587216 Length = 218 Score = 25.4 bits (53), Expect = 8.3 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -3 Query: 147 RGKWRGVQDRSWMWI 103 RG+W ++D+ W+W+ Sbjct: 92 RGRWIHLRDQPWLWL 106 >04_04_1093 + 30825722-30826168,30826457-30826608,30826926-30827048, 30827240-30827384,30828032-30828093,30828373-30828586, 30829671-30830585,30830827-30831076,30831164-30831432 Length = 858 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 27 TVPVETAMVEIKGWKE 74 T P E +VE+KGWKE Sbjct: 597 TCPGECFVVEMKGWKE 612 >01_01_0908 + 7158172-7158356,7159436-7159866,7159953-7161061, 7161372-7162820 Length = 1057 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 123 LEHLAIFLAGNEEREKIAPRSAYEQRDDLSIINGLN*TIYHDTNL 257 + H AGN +K+ P ++ + D+ NGL+ T H T++ Sbjct: 464 VHHTVAHPAGNLSNKKVTPTASTQHDDENDTENGLD-TNMHKTDV 507 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,443,785 Number of Sequences: 37544 Number of extensions: 136721 Number of successful extensions: 410 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 339576272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -