BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O16 (299 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035971-1|AAH35971.1| 414|Homo sapiens HERV-H LTR-associating ... 27 8.2 AF126162-1|AAD48396.1| 414|Homo sapiens HERV-H LTR associating ... 27 8.2 >BC035971-1|AAH35971.1| 414|Homo sapiens HERV-H LTR-associating 2 protein. Length = 414 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 19 FSRRYPWKLLWSRSKAGRKNSKFYYSSYNPHPRPILNTSPFS 144 FS +K+ WSR K+G + YY S + + I+N S FS Sbjct: 250 FSPNQDFKVTWSRMKSGTFSVLAYYLSSSQN--TIINESRFS 289 >AF126162-1|AAD48396.1| 414|Homo sapiens HERV-H LTR associating protein 2 protein. Length = 414 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 19 FSRRYPWKLLWSRSKAGRKNSKFYYSSYNPHPRPILNTSPFS 144 FS +K+ WSR K+G + YY S + + I+N S FS Sbjct: 250 FSPNQDFKVTWSRMKSGTFSVLAYYLSSSQN--TIINESRFS 289 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,725,344 Number of Sequences: 237096 Number of extensions: 738793 Number of successful extensions: 1600 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1600 length of database: 76,859,062 effective HSP length: 76 effective length of database: 58,839,766 effective search space used: 1353314618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -