BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O14 (491 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 38 0.006 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 36 0.014 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 36 0.024 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.024 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.024 SB_15403| Best HMM Match : CH (HMM E-Value=0) 35 0.042 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 34 0.073 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 33 0.097 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 33 0.097 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 33 0.097 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 33 0.17 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 32 0.22 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.30 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 31 0.52 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 31 0.68 SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 2.8 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 2.8 SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) 28 3.6 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 28 3.6 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 28 4.8 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 4.8 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 27 6.4 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 6.4 SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 27 8.4 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_17099| Best HMM Match : zf-MYND (HMM E-Value=2.4e-11) 27 8.4 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C ENC ST + PVCGSDN TY N+ Sbjct: 275 CPENCSSTVD--PVCGSDNNTYDNE 297 Score = 36.3 bits (80), Expect = 0.014 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C ENC ST + PVCG+DN TY N+ Sbjct: 161 CPENCSSTVD--PVCGTDNNTYDNE 183 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQGRL 483 C +NC ST + PVCGSD KTYKN+ L Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYKNECEL 3995 Score = 33.1 bits (72), Expect = 0.13 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKN 471 +C C+ P+ PVCG+D KTY+N Sbjct: 4236 ECPSRCL--PDKEPVCGADGKTYRN 4258 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C ENC ST + PVCGSDN TY N+ Sbjct: 1206 CPENCSSTVD--PVCGSDNNTYDNE 1228 Score = 36.3 bits (80), Expect = 0.014 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C ENC ST + PVCG+DN TY N+ Sbjct: 1135 CPENCSSTVD--PVCGTDNNTYDNE 1157 Score = 31.9 bits (69), Expect = 0.30 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 +C+E+C T PVCGSDN Y N+ Sbjct: 1372 ECSEDCPKT--LKPVCGSDNNDYDNE 1395 Score = 31.1 bits (67), Expect = 0.52 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQGRL 483 C +C P+CGS+NKTY N+ L Sbjct: 289 CPSSCGDESLPQPICGSNNKTYANECEL 316 Score = 30.7 bits (66), Expect = 0.68 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +1 Query: 433 NPVCGSDNKTYKNQGRL 483 +PVCGSD+KTY N+ R+ Sbjct: 617 DPVCGSDSKTYPNECRM 633 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C ++C T E P+C SD +TY N+ Sbjct: 2154 CPDDC--TNETKPICASDGQTYDNE 2176 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 433 NPVCGSDNKTYKNQGRL 483 +PVCGSDN TY ++ +L Sbjct: 227 DPVCGSDNVTYASECQL 243 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C + C T +PVC SDN TY N+ Sbjct: 1580 CPKICPIT--LDPVCASDNNTYPNE 1602 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 36.3 bits (80), Expect = 0.014 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C ENC ST + PVCG+DN TY N+ Sbjct: 27 CPENCSSTVD--PVCGTDNNTYDNE 49 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 35.5 bits (78), Expect = 0.024 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C+ I T EY+P+CGSD KTY NQ Sbjct: 5152 CSCPDICTFEYSPLCGSDGKTYDNQ 5176 Score = 33.9 bits (74), Expect = 0.073 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKNQ 474 C N I T EY PVCG+D ++Y N+ Sbjct: 5222 CTCNSICTLEYAPVCGTDGQSYDNE 5246 Score = 33.1 bits (72), Expect = 0.13 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 412 CISTPEYN-PVCGSDNKTYKNQGRL 483 C S P N PVCGSD KTY N+ L Sbjct: 5621 CQSCPSINKPVCGSDGKTYNNECEL 5645 Score = 30.7 bits (66), Expect = 0.68 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 412 CISTPEY-NPVCGSDNKTYKNQGRL 483 C+S P +PVCGSD K Y N+ L Sbjct: 5790 CLSCPNILDPVCGSDGKNYDNECNL 5814 Score = 29.9 bits (64), Expect = 1.2 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +1 Query: 427 EYNPVCGSDNKTYKNQ 474 +Y PVCG+D +TY+N+ Sbjct: 5558 DYTPVCGTDGETYENE 5573 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQGRL 483 +C + I + Y PVCG+D + Y N+ L Sbjct: 5292 ECVCDGICSLVYAPVCGTDGQEYSNECNL 5320 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 35.5 bits (78), Expect = 0.024 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = +1 Query: 385 QTIEKCAENCISTPEYNPVCGSDNKTYKN 471 Q + C E C T EY PVCGSD KTY N Sbjct: 37 QPVCVCNEAC--TREYAPVCGSDGKTYPN 63 Score = 35.5 bits (78), Expect = 0.024 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKN 471 +C + C T +Y PVCGSDNKTY N Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTYAN 217 Score = 30.7 bits (66), Expect = 0.68 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 +C + C T EY P CG+D TY N+ Sbjct: 278 ECPKAC--TREYKPACGTDGNTYPNR 301 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKN 471 +C C T E PVCG+D KTY N Sbjct: 117 ECPRAC--TRELMPVCGTDQKTYDN 139 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 35.5 bits (78), Expect = 0.024 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKN 471 +C C T E NPVCGSD KTY N Sbjct: 117 RCMRRC--TKELNPVCGSDGKTYDN 139 Score = 33.9 bits (74), Expect = 0.073 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +1 Query: 394 EKCAENCISTPEYNPVCGSDNKTYKN 471 +KCA C Y PVCGSDN TY N Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSN 190 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 391 IEKCAENCISTPEYNPVCGSDNKTYKNQ 474 ++ C C + Y PVCG+D KTY N+ Sbjct: 41 VDPCVRPCPAI--YMPVCGTDGKTYGNK 66 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 34.7 bits (76), Expect = 0.042 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKN 471 KC + T EY PVCGSD TY N Sbjct: 721 KCVCSAACTREYAPVCGSDGNTYNN 745 Score = 32.3 bits (70), Expect = 0.22 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKN 471 +C + P Y+P+CG+D KTY N Sbjct: 1232 RCECDLRPDPAYDPICGTDGKTYNN 1256 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 +C +C S Y PVCG D +TY N+ Sbjct: 972 ECPRSCPSV-NY-PVCGDDGQTYDNE 995 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 34.7 bits (76), Expect = 0.042 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 421 TPEYNPVCGSDNKTYKNQGRL 483 T +YNPVCGSD +TY N+ + Sbjct: 15 TADYNPVCGSDGRTYPNRASM 35 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 33.9 bits (74), Expect = 0.073 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +1 Query: 394 EKCAENCISTPEYNPVCGSDNKTYKN 471 +KCA C Y PVCGSDN TY N Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSN 47 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 33.5 bits (73), Expect = 0.097 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +1 Query: 394 EKCAENCISTPEYNPVCGSDNKTYKN 471 +KCA C Y PVCGSDN TY N Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSN 61 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 33.5 bits (73), Expect = 0.097 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 397 KCAEN-CISTPEYNPVCGSDNKTYKN 471 KC ++ + T +Y+PVCGSD KTY N Sbjct: 24 KCDDSPTLCTLQYDPVCGSDGKTYGN 49 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 33.5 bits (73), Expect = 0.097 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 391 IEKCAENCISTPEYNPVCGSDNKTYKNQ 474 I +C N T Y PVCG+D KTY N+ Sbjct: 34 IVRCVCNRACTKIYRPVCGTDGKTYGNK 61 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 32.7 bits (71), Expect = 0.17 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 385 QTIEKCAENCISTPEYNPVCGSDNKTYKNQ 474 Q + +C C T EY PVCGSD KTY + Sbjct: 42 QPVCECPMAC--TREYAPVCGSDGKTYPTE 69 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 32.3 bits (70), Expect = 0.22 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 409 NCISTPEYNPVCGSDNKTYKNQ 474 NC ST + PVCGSDN TY N+ Sbjct: 2 NCSSTVD--PVCGSDNNTYDNE 21 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 32.3 bits (70), Expect = 0.22 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 KC C T EY PVCG+D KTY N+ Sbjct: 1294 KCPIFC--TYEYMPVCGTDGKTYGNK 1317 Score = 32.3 bits (70), Expect = 0.22 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 +C ++T EY PVC SD K Y N+ Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIYPNR 1991 Score = 31.5 bits (68), Expect = 0.39 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 KC + + T +Y PVC SD KTY N+ Sbjct: 1522 KCRQ--MMTADYTPVCASDGKTYPNR 1545 Score = 30.3 bits (65), Expect = 0.90 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQGRL 483 KC + I +P +PVCGSD K YK+ L Sbjct: 1753 KCPPS-ICSPVISPVCGSDGKIYKDDCEL 1780 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 421 TPEYNPVCGSDNKTYKN 471 T +Y+PVC SD +TY N Sbjct: 1818 TADYSPVCASDGQTYPN 1834 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 +C I Y+PVCGSD Y N+ Sbjct: 1364 QCVCPSICPLHYSPVCGSDGNMYSNE 1389 Score = 27.1 bits (57), Expect = 8.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 430 YNPVCGSDNKTYKNQ 474 Y+PVC S+ KTY N+ Sbjct: 1604 YDPVCASNGKTYSNR 1618 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 31.9 bits (69), Expect = 0.30 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 427 EYNPVCGSDNKTYKNQGRL 483 E +PVCGSD KTY+N+ +L Sbjct: 516 EASPVCGSDGKTYENECKL 534 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKN 471 C NC S +++PVCG D TY+N Sbjct: 579 CPTNCPS--DWDPVCGDDGVTYQN 600 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 382 RQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRL 483 RQ + C ++ PVCGSD +TY N RL Sbjct: 430 RQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRL 463 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQGRL 483 KC+ P PVCGSD K+Y ++ L Sbjct: 1679 KCSCPIYCPPSGQPVCGSDGKSYGSECEL 1707 Score = 28.3 bits (60), Expect = 3.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +1 Query: 430 YNPVCGSDNKTYKN 471 Y+PVCGS+ KTY N Sbjct: 1830 YDPVCGSNRKTYLN 1843 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 409 NCISTPEYNPVCGSDNKTYKNQ 474 +C P+ PVCG+DNK Y N+ Sbjct: 816 SCDKMPD--PVCGTDNKEYANE 835 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 31.1 bits (67), Expect = 0.52 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 391 IEKCAENCISTPEYN-PVCGSDNKTYKNQ 474 ++KC C P N PVCG+D KTY N+ Sbjct: 21 VDKCVRPC---PAINDPVCGTDGKTYGNE 46 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 30.7 bits (66), Expect = 0.68 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 412 CISTPEY-NPVCGSDNKTYKNQGRL 483 C+S P +PVCGSD K Y N+ L Sbjct: 111 CLSCPNILDPVCGSDGKNYDNECNL 135 Score = 30.7 bits (66), Expect = 0.68 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 412 CISTPEYN-PVCGSDNKTYKNQGRL 483 C+S P+ N PVCGS+ K Y N+ L Sbjct: 205 CMSCPKMNKPVCGSNGKDYNNECEL 229 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 412 CISTPEY-NPVCGSDNKTYKNQGRL 483 C+S P +PVCGSD K Y N +L Sbjct: 274 CLSCPNMLDPVCGSDGKNYDNVCKL 298 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 30.7 bits (66), Expect = 0.68 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 391 IEKCAENCISTPEYNPVCGSDNKTYKNQ 474 I +C N Y+P+CG+D KTY N+ Sbjct: 34 IARCVCNRACKKIYSPMCGTDGKTYGNK 61 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 88 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 222 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKN 471 C +C T Y+PVCG D TY N Sbjct: 252 CPSDCSHT--YSPVCGGDKTTYIN 273 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 436 PVCGSDNKTYKNQ 474 PVCGSD KTY N+ Sbjct: 1078 PVCGSDGKTYNNE 1090 >SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) Length = 396 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 397 KCAENCISTPEYNPV-CGSDNKTYKN 471 +CAE+C P Y+ CGSD TYKN Sbjct: 20 ECAESC---PTYDDERCGSDGVTYKN 42 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 28.3 bits (60), Expect = 3.6 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +1 Query: 100 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 279 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 280 NFIAFIFP 303 + IFP Sbjct: 669 GDMNTIFP 676 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQGRL 483 +C E C S E +PVCG+D +TY ++ L Sbjct: 205 RCHEPCPS--EASPVCGTDMRTYASRCHL 231 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 3.6 Identities = 9/37 (24%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +2 Query: 11 LYLYLCYKICHINYFYY----YNLKWISCARFLYWVL 109 ++L+ +CH+NY Y+ +++ W+ ++Y V+ Sbjct: 121 IWLFHVSLLCHVNYMYHVIWLFHVSWLCHVNYMYHVI 157 >SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 397 KCAENCISTPEYNPV-CGSDNKTYKN 471 +CAE+C P Y+ CGSD TYKN Sbjct: 174 ECAESC---PTYDDERCGSDGVTYKN 196 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 400 CAENCISTPEYNPVCGSDNKTYKN 471 C+ +C PVCGSD+ TY N Sbjct: 8 CSFSCDDGFHQTPVCGSDDVTYAN 31 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 4.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 103 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 234 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 27.5 bits (58), Expect = 6.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 400 CAENCISTPEYNPVC 444 C +CISTP Y+ +C Sbjct: 1196 CVHSCISTPRYDQIC 1210 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 27.5 bits (58), Expect = 6.4 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +1 Query: 436 PVCGSDNKTYKN 471 PVCGSD KTY N Sbjct: 246 PVCGSDGKTYTN 257 >SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 353 HQLLALVEHHDKQLRNARRIAFQHQNTTPC 442 H L AL +++R RRI+++ QNT C Sbjct: 84 HSLPALTFESARKVRQYRRISWEGQNTQTC 113 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 27.1 bits (57), Expect = 8.4 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 412 CISTPEYNPVCGSDNKTY 465 C+ + ++NPVCG+D+ TY Sbjct: 137 CVKS-QFNPVCGADDVTY 153 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +1 Query: 397 KCAENCIST-PEY-NPVCGSDNKTYKNQGRL 483 K + C+S P++ PVCGSD TY N L Sbjct: 76 KASCECLSECPDHIKPVCGSDGVTYPNHCEL 106 >SB_17099| Best HMM Match : zf-MYND (HMM E-Value=2.4e-11) Length = 200 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 490 HKIVFPGFCKF--YYRYHTRGCILVLKCNSPRISQLF 386 H+ VF C+ Y+ ++ C LVL+C PR ++ + Sbjct: 82 HRTVFVFCCRNGKCYKRNSNDCFLVLRCQLPRKNKFY 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,201,256 Number of Sequences: 59808 Number of extensions: 334195 Number of successful extensions: 991 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -