BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O14 (491 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical p... 33 0.15 AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synapt... 33 0.15 U40415-5|AAK39251.1| 655|Caenorhabditis elegans Hypothetical pr... 31 0.34 AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical... 30 0.79 Z78543-1|CAB01753.2| 1170|Caenorhabditis elegans Hypothetical pr... 29 1.8 Z81112-6|CAB03277.1| 673|Caenorhabditis elegans Hypothetical pr... 28 4.2 Z77136-10|CAB00887.1| 673|Caenorhabditis elegans Hypothetical p... 28 4.2 AL117207-17|CAI79269.1| 421|Caenorhabditis elegans Hypothetical... 27 9.8 AC024881-9|AAK71410.1| 588|Caenorhabditis elegans Hypothetical ... 27 9.8 >U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical protein F41G3.12 protein. Length = 1483 Score = 32.7 bits (71), Expect = 0.15 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 421 TPEYNPVCGSDNKTYKNQGRL 483 T E+ VCGSD KTY N+ RL Sbjct: 469 TDEFKEVCGSDGKTYSNECRL 489 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 KC+E C + VCG+D KTY N+ Sbjct: 318 KCSEQCTMNSAH--VCGTDGKTYLNE 341 >AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synaptic protein) homologfamily member protein. Length = 1473 Score = 32.7 bits (71), Expect = 0.15 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 421 TPEYNPVCGSDNKTYKNQGRL 483 T E+ VCGSD KTY N+ RL Sbjct: 477 TDEFKEVCGSDGKTYSNECRL 497 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 397 KCAENCISTPEYNPVCGSDNKTYKNQ 474 KC+E C + VCG+D KTY N+ Sbjct: 326 KCSEQCTMNSAH--VCGTDGKTYLNE 349 >U40415-5|AAK39251.1| 655|Caenorhabditis elegans Hypothetical protein K02G10.5 protein. Length = 655 Score = 31.5 bits (68), Expect = 0.34 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 391 IEKCAENCISTPEYNPVCGSDNK 459 +E C+ENC +NPVC D+K Sbjct: 442 LETCSENCHCDSFFNPVCSEDSK 464 >AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical protein Y37A1B.11 protein. Length = 691 Score = 30.3 bits (65), Expect = 0.79 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +2 Query: 326 KHRYQVKGKHQLLALVEHHDKQLRNARRIAFQHQNTTPCVVAIIKLTKTREDYF 487 + R++ + +H AL +H ++L +R A + CV+++IK + E F Sbjct: 81 EQRHRRRRRHNETALEDHLSEKLSREKRAAAHIMRSRKCVISVIKKMSSMECSF 134 >Z78543-1|CAB01753.2| 1170|Caenorhabditis elegans Hypothetical protein F29G6.1 protein. Length = 1170 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 382 RQTIEKCAENCISTPEYNPVCGSDNKTYKN 471 R + + C NC +T E++PVC ++ Y+N Sbjct: 109 RCSSKDCNHNCTNT-EFDPVCDTNGSVYRN 137 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 409 NCISTPEYNPVCGSDNKTYKNQGRLFC 489 +C PVCG+DN TY N L C Sbjct: 18 DCDCPSVIRPVCGTDNVTYNNLCFLRC 44 >Z81112-6|CAB03277.1| 673|Caenorhabditis elegans Hypothetical protein ZC376.3 protein. Length = 673 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 406 ENCISTPEYNPVCGSD-NKTYKN 471 + + T EY P C SD KTYKN Sbjct: 73 DGILETKEYKPACMSDAKKTYKN 95 >Z77136-10|CAB00887.1| 673|Caenorhabditis elegans Hypothetical protein ZC376.3 protein. Length = 673 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 406 ENCISTPEYNPVCGSD-NKTYKN 471 + + T EY P C SD KTYKN Sbjct: 73 DGILETKEYKPACMSDAKKTYKN 95 >AL117207-17|CAI79269.1| 421|Caenorhabditis elegans Hypothetical protein Y60A3A.25 protein. Length = 421 Score = 26.6 bits (56), Expect = 9.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 178 IDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNN 276 +D + + QD N W+ + N + Q P DNN Sbjct: 106 MDMQPYQEYQDNNESGWVDLNNDNQFQQP-DNN 137 >AC024881-9|AAK71410.1| 588|Caenorhabditis elegans Hypothetical protein Y97E10B.1 protein. Length = 588 Score = 26.6 bits (56), Expect = 9.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 457 YYRYHTRGCILVLKCNSPRI 398 YYRYH G I +KC P++ Sbjct: 523 YYRYHYSGRIGEIKCPGPQL 542 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,072,323 Number of Sequences: 27780 Number of extensions: 262274 Number of successful extensions: 709 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 924715866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -