BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O13 (514 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 1.6 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 4.9 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 4.9 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 23.0 bits (47), Expect = 1.6 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 12 VKMVLCLILLLFYSFNGVTSNNTSIL-SNF 98 V V+C +LL+F + V+S T L +NF Sbjct: 3 VVFVVCCLLLMFSYTDNVSSTRTKYLRTNF 32 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 284 FQFIRVETILKGILQRF 234 F + ++T+L GIL++F Sbjct: 440 FAMLEIKTVLCGILKKF 456 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 284 FQFIRVETILKGILQRF 234 F + ++T+L GIL++F Sbjct: 440 FAMLEIKTVLCGILKKF 456 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,840 Number of Sequences: 336 Number of extensions: 2261 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -