BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O09 (544 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g28300.1 68418.m03436 trihelix DNA-binding protein, putative ... 29 2.7 At3g19516.1 68416.m02474 hypothetical protein 29 2.7 At3g19820.2 68416.m02511 cell elongation protein / DWARF1 / DIMI... 27 6.1 At3g19820.1 68416.m02510 cell elongation protein / DWARF1 / DIMI... 27 6.1 At2g30240.1 68415.m03680 cation/hydrogen exchanger, putative (CH... 27 6.1 At1g33680.1 68414.m04166 KH domain-containing protein similar to... 27 8.1 >At5g28300.1 68418.m03436 trihelix DNA-binding protein, putative similar to GT-2 factor [Arabidopsis thaliana GI:416490 Length = 619 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 46 HDYSLNAHYYYHHLTYNKWLGGDVVPLLKERRGEWYWF 159 HD S N H ++HH + W +V+ LL+ R WF Sbjct: 88 HDDSDNHHQHHHH---HPWCSDEVLALLRFRSTVENWF 122 >At3g19516.1 68416.m02474 hypothetical protein Length = 143 Score = 28.7 bits (61), Expect = 2.7 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Frame = +1 Query: 346 LEKIKDYERRLRDGIENG-----YIINSTGDHVPIHTPE-GIDILGRLIEAGVASPNVQY 507 +EK+KD+E+RLR+ E Y+ I T E G D++ R + + N + Sbjct: 1 MEKLKDFEKRLRESTEKSQNLKDYLGIIEFSKTSIETKELGADLIPRYFQFYTSHSNQAF 60 Query: 508 --YKDFISS 528 YKD I + Sbjct: 61 DAYKDIIEA 69 >At3g19820.2 68416.m02511 cell elongation protein / DWARF1 / DIMINUTO (DIM) identical to GB:S71189 [SP|Q39085] from [Arabidopsis thaliana]; contains Pfam FAD binding domain PF01565 Length = 561 Score = 27.5 bits (58), Expect = 6.1 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +1 Query: 4 WHY-HCQSASMSYYLHDYSLNAHYYYHHLTYNKWLGGDVVPLLKERRGEWYWF 159 W Y H Q+A +Y YY+ H W G ++P G+ +WF Sbjct: 312 WFYQHAQTALKKGQFVEYIPTREYYHRHTRCLYWEGKLILPF-----GDQFWF 359 >At3g19820.1 68416.m02510 cell elongation protein / DWARF1 / DIMINUTO (DIM) identical to GB:S71189 [SP|Q39085] from [Arabidopsis thaliana]; contains Pfam FAD binding domain PF01565 Length = 561 Score = 27.5 bits (58), Expect = 6.1 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +1 Query: 4 WHY-HCQSASMSYYLHDYSLNAHYYYHHLTYNKWLGGDVVPLLKERRGEWYWF 159 W Y H Q+A +Y YY+ H W G ++P G+ +WF Sbjct: 312 WFYQHAQTALKKGQFVEYIPTREYYHRHTRCLYWEGKLILPF-----GDQFWF 359 >At2g30240.1 68415.m03680 cation/hydrogen exchanger, putative (CHX13) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 831 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 322 DHPEYLGELEKIKDYERRLRDGIENGYIINSTGD 423 D Y KI E +RDG+E +I+S GD Sbjct: 701 DFKSYAANKGKIHYVEEIVRDGVETTQVISSLGD 734 >At1g33680.1 68414.m04166 KH domain-containing protein similar to FUSE binding protein 2 GB:AAC50892 GI:1575607 from [Homo sapiens] Length = 759 Score = 27.1 bits (57), Expect = 8.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 256 YNFGYMYHNGIPYPVRPNHF 315 ++ Y YH+G PYP + +HF Sbjct: 423 HSMPYNYHHGGPYPSQGSHF 442 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,652,471 Number of Sequences: 28952 Number of extensions: 251392 Number of successful extensions: 752 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -