BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O06 (510 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.34 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 2.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.4 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 4.2 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 7.4 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 7.4 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 7.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.4 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 7.4 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 7.4 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.8 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 9.8 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.4 bits (53), Expect = 0.34 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 179 YYTPERNPKEADYTAPIYAPQN 244 Y+ E++PK+ T P APQN Sbjct: 302 YFRAEKDPKKMPCTQPPSAPQN 323 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.6 bits (46), Expect = 2.4 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +2 Query: 275 INYWIQNGAPTHKLVLGIST 334 +++WI + A + ++ LGI+T Sbjct: 261 VSFWINHEATSARVALGITT 280 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 369 EISGVPPIHAD*GGEACSYYKGPRL 443 +++ PP D GE YY G RL Sbjct: 994 KVTWKPPPREDWNGEILGYYVGYRL 1018 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.8 bits (44), Expect = 4.2 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 275 INYWIQNGAPTHKLVLGIST--TGRTWKLESK 364 +++WI A + ++ LGI+T T T L+S+ Sbjct: 264 VSFWIHREATSDRVGLGITTVLTLSTISLDSR 295 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 7.4 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 275 INYWIQNGAPTHKLVLGISTTGRTWKLESK 364 +++W+ A ++VLG +T L SK Sbjct: 251 VSFWLHMDASPPRIVLGTNTILTFMTLASK 280 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 7.4 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 275 INYWIQNGAPTHKLVLGIST 334 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 7.4 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 275 INYWIQNGAPTHKLVLGIST 334 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 7.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 72 ICS*LSAFCQT*IAPFTLTS 131 IC+ L+A CQ + F +TS Sbjct: 644 ICTKLTADCQPGVTAFIVTS 663 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.4 Identities = 17/75 (22%), Positives = 30/75 (40%), Gaps = 8/75 (10%) Frame = +2 Query: 2 ESEHREGFTALVREMKQALNVKPNMQLVISVLPNV-NSSIYFDV--PSIINLV-----DI 157 E +H+ F + + + P ++ SV N++ Y P ++ D+ Sbjct: 279 EQQHKAMFLVVTAQPVHSAYKAPEETIISSVFTTRHNATCYLSHVDPDVVQYFGYLPQDM 338 Query: 158 VNIQAFDYYTPERNP 202 V FD+Y PE P Sbjct: 339 VGRSLFDFYHPEDLP 353 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.0 bits (42), Expect = 7.4 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 275 INYWIQNGAPTHKLVLGIST 334 +++W+ A ++ LG++T Sbjct: 179 VSFWLNRNATPARVALGVTT 198 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 7.4 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 269 RRRFVEDRGSAVRKSVQCSPPLWGYVQVY 183 R+ + EDR +R+ P + QVY Sbjct: 14 RQVYGEDRWEEIRRQASVEQPSFSVHQVY 42 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 9.8 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +2 Query: 275 INYWIQNGAPTHKLVLGIST 334 +++W+ A ++ LGI+T Sbjct: 233 VSFWLNREATADRVSLGITT 252 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 20.6 bits (41), Expect = 9.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 152 DIVNIQAFDYYTPERNP 202 D+V FD+Y PE P Sbjct: 43 DMVGRSLFDFYHPEDLP 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,788 Number of Sequences: 438 Number of extensions: 3119 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -