BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O04 (566 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65620.1 68418.m08255 peptidase M3 family protein / thimet ol... 28 3.8 At5g15830.1 68418.m01852 bZIP transcription factor family protei... 28 3.8 At5g19820.1 68418.m02355 PBS lyase HEAT-like repeat-containing p... 28 5.0 At3g24495.1 68416.m03072 DNA mismatch repair protein MSH6-2 (MSH... 28 5.0 At2g06820.1 68415.m00761 expressed protein low similarity to zin... 27 6.6 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 27 6.6 At5g33210.1 68418.m03923 zinc finger protein-related similar to ... 27 8.7 At4g28715.1 68417.m04107 myosin heavy chain, putative similar to... 27 8.7 At3g51060.1 68416.m05591 zinc finger protein, putative / lateral... 27 8.7 At3g03960.1 68416.m00415 chaperonin, putative similar to SWISS-P... 27 8.7 >At5g65620.1 68418.m08255 peptidase M3 family protein / thimet oligopeptidase family protein similar to SP|P27237 Oligopeptidase A (EC 3.4.24.70) {Salmonella typhimurium}; contains Pfam profile PF01432: Peptidase family M3 Length = 791 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 512 IWASSLATFMPPRISLASISTSSGFFRLIMVPSRRS 405 IW+SS + +PP S S S SS FR P S Sbjct: 44 IWSSSFSFCLPPPRSTTSTSLSSSSFRPFSSPPSMS 79 >At5g15830.1 68418.m01852 bZIP transcription factor family protein similar to common plant regulatory factor 7 GI:9650828 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 186 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/92 (18%), Positives = 48/92 (52%), Gaps = 1/92 (1%) Frame = +1 Query: 103 TDEVYGLNKERQGEILMYANSQLLARLRMERLSHKMCDIKMFMWNEPVKNGYWPKI-RLP 279 T+E++ +N+ +Q M +N + R RM + H + W + K+ ++ Sbjct: 65 TEEIFVINERKQRR--MVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVS 122 Query: 280 NGDEMPVRQNNFVPVTSENLKLKMLLDDVEQM 375 + +++ +++N+ + ENL+L+ ++ ++++ Sbjct: 123 DNNDLVIQENS--SLKEENLELRQVITSMKKL 152 >At5g19820.1 68418.m02355 PBS lyase HEAT-like repeat-containing protein contains Pfam profile: PF03130 PBS lyase HEAT-like repeat Length = 1116 Score = 27.9 bits (59), Expect = 5.0 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 340 KLKMLLDDVEQMIREGILTGKIERRDGTMINLKKPEDVEM-LARLILGGMNVANDDAQMF 516 KL +LL + +QM++EG LT D + + +K D M + IL MN + +M Sbjct: 508 KLLVLLQNGKQMVQEGALTALASVADSSQEHFQKYYDTVMPYLKTIL--MNATDKSKRML 565 Query: 517 HMMTM 531 +M Sbjct: 566 RAKSM 570 >At3g24495.1 68416.m03072 DNA mismatch repair protein MSH6-2 (MSH7) identical to SP|Q9SMV7 DNA mismatch repair protein MSH6-2 (AtMsh6-2) (MutS homolog 7) {Arabidopsis thaliana}; GC donor splice site at exon 11 Length = 1109 Score = 27.9 bits (59), Expect = 5.0 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +1 Query: 286 DEMPVRQNNFVPVTSENLKLKMLLDDV---EQMIREGILTGKIERRDGTMINLKKPED 450 DEM +++ VPV N +LKML D V ++ + EG +E N ++P+D Sbjct: 193 DEMTFKEDK-VPVLDSNKRLKMLQDPVCGEKKEVNEGTKFEWLESSRIRDANRRRPDD 249 >At2g06820.1 68415.m00761 expressed protein low similarity to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 267 Score = 27.5 bits (58), Expect = 6.6 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +1 Query: 322 VTSENLKLKMLLDDVEQMIREGIL 393 +TS ++K+K+LLD ++ +I+E I+ Sbjct: 151 ITSSSVKIKVLLDGLQPLIKETIV 174 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +1 Query: 286 DEMPV-RQNNFVPVTSENLKLKMLLDDVEQMIRE 384 DE+PV Q+ + + +EN KLK L+ +E+ I E Sbjct: 1037 DEVPVIDQSAIIKLETENQKLKALVSSMEEKIDE 1070 >At5g33210.1 68418.m03923 zinc finger protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702), TIGR01623: putative zinc finger domain, LRP1 type Length = 173 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 262 PKIRLPNGDEMPVRQNNFVPVTSENL 339 P+ +LP G+ +P R +P TS +L Sbjct: 105 PQTQLPRGESVPKRHRENLPATSSSL 130 >At4g28715.1 68417.m04107 myosin heavy chain, putative similar to myosin [Arabidopsis thaliana] gi|499047|emb|CAA84066 Length = 639 Score = 27.1 bits (57), Expect = 8.7 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 274 LPNGDEMPVRQNNFVP-VTSENLKLKMLLDDVEQMIRE 384 +P E+PV V +TSEN KLK L+ ++Q I E Sbjct: 87 VPVLQEVPVVDTELVEKLTSENEKLKSLVSSLDQKIDE 124 >At3g51060.1 68416.m05591 zinc finger protein, putative / lateral root primordium (LRP) protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702) Length = 252 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 262 PKIRLPNGDEMPVRQNNFVPVTSENL 339 P+ +LP G+ +P R +P TS +L Sbjct: 197 PQTQLPRGESVPKRHRENLPATSSSL 222 >At3g03960.1 68416.m00415 chaperonin, putative similar to SWISS-PROT:P42932- T-complex protein 1, theta subunit (TCP-1-theta) [Mus musculus]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 549 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 352 LLDDVEQMIREGILTGKIERRDGTMINLKKPEDVEMLARL 471 +LDD+E+ + +G+ T K RD ++ ++E+ RL Sbjct: 387 ILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIELAQRL 426 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,673,793 Number of Sequences: 28952 Number of extensions: 234180 Number of successful extensions: 667 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -