BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O03 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 4.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 22 4.7 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 22 4.7 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.3 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 Query: 437 LPQPVPLVLREGQDAQR 487 LP+P PLV ++G + +R Sbjct: 236 LPKPTPLVPQQGFNMER 252 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 85 ATLDDTLCDDHLAFICEKDPKKLQT 159 AT+D+ D H + + PKK+ T Sbjct: 642 ATIDEAASDVHQTHMRIRPPKKIPT 666 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 85 ATLDDTLCDDHLAFICEKDPKKLQT 159 AT+D+ D H + + PKK+ T Sbjct: 642 ATIDEAASDVHQTHMRIRPPKKIPT 666 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 85 ATLDDTLCDDHLAFICEKDPKKLQT 159 AT+D+ D H + + PKK+ T Sbjct: 642 ATIDEAASDVHQTHMRIRPPKKIPT 666 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 85 ATLDDTLCDDHLAFICEKDPKKLQT 159 AT+D+ D H + + PKK+ T Sbjct: 642 ATIDEAASDVHQTHMRIRPPKKIPT 666 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 377 QRCCGVYLRSGDQKYT*YIHFMLLFMAQNP 288 +R V L + DQK +H L+ + +NP Sbjct: 346 ERLLNVNLSAVDQKTRQEVHMFLMAIEKNP 375 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 377 QRCCGVYLRSGDQKYT*YIHFMLLFMAQNP 288 +R V L + DQK +H L+ + +NP Sbjct: 346 ERLLNVNLSAVDQKTRQEVHMFLMAIEKNP 375 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 406 KFLAHAHDDG 377 KF++H H+DG Sbjct: 230 KFMSHIHNDG 239 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,681 Number of Sequences: 336 Number of extensions: 2601 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -