BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O03 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 65 4e-11 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 65 5e-11 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 56 2e-08 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 55 5e-08 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 54 9e-08 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 52 4e-07 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 51 7e-07 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 51 9e-07 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 50 2e-06 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 49 3e-06 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 49 3e-06 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_15403| Best HMM Match : CH (HMM E-Value=0) 48 8e-06 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 44 8e-05 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 43 2e-04 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 42 4e-04 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 42 4e-04 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 41 7e-04 SB_44627| Best HMM Match : Kazal_1 (HMM E-Value=3.19496e-43) 40 0.002 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 38 0.009 SB_25348| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) 37 0.015 SB_14008| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) 37 0.015 SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_7990| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.061 SB_22525| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) 33 0.25 SB_42813| Best HMM Match : Lectin_C (HMM E-Value=4.8e-21) 32 0.43 SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_27078| Best HMM Match : Kazal_2 (HMM E-Value=7.6e-07) 31 0.75 SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) 31 0.99 SB_5272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 31 0.99 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 30 1.7 SB_55359| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_58330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_12293| Best HMM Match : OATP (HMM E-Value=0) 29 3.0 SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) 29 4.0 SB_3993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_8855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) 28 5.3 SB_11598| Best HMM Match : Kazal_2 (HMM E-Value=2.1e-05) 28 5.3 SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 65.3 bits (152), Expect = 4e-11 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 6/81 (7%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEE---ADPC---VCTFIY 551 AC R PVCGSDGKTY N C L E KT++ + ++K+G+C++ +DPC +C+F Sbjct: 45 ACTREYAPVCGSDGKTYPNPCALEVESCKTNTRISVIKKGSCDDSALSDPCDIALCSFPQ 104 Query: 552 APVCGTDGNT*PNKCSLECSR 614 + +C T +C C+R Sbjct: 105 S-ICVNVNGTATCECPRACTR 124 Score = 47.2 bits (107), Expect = 1e-05 Identities = 32/84 (38%), Positives = 39/84 (46%), Gaps = 10/84 (11%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSD-LKIVKEGTC------EEADPC---VC 539 AC R L PVCG+D KTY N CLL ER D L + EG C PC +C Sbjct: 121 ACTRELMPVCGTDQKTYDNMCLL--ERAACKDDGLMLAHEGPCPTKVNESSVSPCEISLC 178 Query: 540 TFIYAPVCGTDGNT*PNKCSLECS 611 +F P+C T +C C+ Sbjct: 179 SF-PRPICVEVNGTATCECPKVCT 201 Score = 46.4 bits (105), Expect = 2e-05 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 AC R +P CG+DG TY N+C+L + +T L++ +G C Sbjct: 282 ACTREYKPACGTDGNTYPNRCVLAIQSCETGEKLQLAHDGPC 323 Score = 44.8 bits (101), Expect = 6e-05 Identities = 36/105 (34%), Positives = 44/105 (41%), Gaps = 35/105 (33%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHS--DLKIVKEGTCEEA--------DPC--- 533 C + PVCGSD KTY N C L E K + L+++ +G C DPC Sbjct: 200 CTLDYTPVCGSDNKTYANLCNLEVEACKPENTDKLQLLHDGPCPPTPDNTSPPLDPCEIT 259 Query: 534 VCTF----------------------IYAPVCGTDGNT*PNKCSL 602 +C F Y P CGTDGNT PN+C L Sbjct: 260 LCAFPRTKCRVKDNTAVCECPKACTREYKPACGTDGNTYPNRCVL 304 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +3 Query: 510 TCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 TCE P VCT Y PVCG+D T N C+LE Sbjct: 193 TCE--CPKVCTLDYTPVCGSDNKTYANLCNLE 222 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 64.9 bits (151), Expect = 5e-11 Identities = 30/73 (41%), Positives = 39/73 (53%), Gaps = 3/73 (4%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC-EEADPC--VCTFIYAPVC 563 C + L PVCGSDGKTY N C+ + + L++ G C D C +C +Y PVC Sbjct: 122 CTKELNPVCGSDGKTYDNPCVFKIAVCQMNGQLRLKHRGACGSRPDKCAPICNKMYQPVC 181 Query: 564 GTDGNT*PNKCSL 602 G+D T N C L Sbjct: 182 GSDNVTYSNPCML 194 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +3 Query: 378 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 P CA C + +PVCGSD TY N C+L K++ + + G C + C Sbjct: 166 PDKCAPICNKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSQSC 219 Score = 42.7 bits (96), Expect = 2e-04 Identities = 31/95 (32%), Positives = 42/95 (44%), Gaps = 27/95 (28%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLL-------------------------YCERDKTHSDLKI 497 C PVCG+DGKTY N+C+L YCE+D + +K+ Sbjct: 48 CPAIYMPVCGTDGKTYGNKCMLGAATCRSNGTITLAYPGECIVEKGYYCEKDAADA-IKM 106 Query: 498 VKEGTCEEADPCV--CTFIYAPVCGTDGNT*PNKC 596 + E + C+ CT PVCG+DG T N C Sbjct: 107 ILEAVWGSSLRCMRRCTKELNPVCGSDGKTYDNPC 141 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/28 (67%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = +3 Query: 525 DPCV--CTFIYAPVCGTDGNT*PNKCSL 602 DPCV C IY PVCGTDG T NKC L Sbjct: 42 DPCVRPCPAIYMPVCGTDGKTYGNKCML 69 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 56.0 bits (129), Expect = 2e-08 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 23/94 (24%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEE-------ADP------- 530 C PVCG+DG++Y N+CLL + + +++ +GTC+ A P Sbjct: 5228 CTLEYAPVCGTDGQSYDNECLLQTASCQRNELIEVATQGTCDPCVGFTCVAPPYSYCKAR 5287 Query: 531 -----CV----CTFIYAPVCGTDGNT*PNKCSLE 605 CV C+ +YAPVCGTDG N+C+L+ Sbjct: 5288 DGRPECVCDGICSLVYAPVCGTDGQEYSNECNLQ 5321 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 21/91 (23%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE--EADPCV---------- 536 C+ + PVCG+DG+TY N+C L + + +++ +G C + PC Sbjct: 5555 CSLDYTPVCGTDGETYENECTLQISSCQRNEQVEVASQGHCHPCQRSPCTVPYSRCVLIR 5614 Query: 537 ---------CTFIYAPVCGTDGNT*PNKCSL 602 C I PVCG+DG T N+C L Sbjct: 5615 GQAVCMCQSCPSINKPVCGSDGKTYNNECEL 5645 Score = 48.4 bits (110), Expect = 5e-06 Identities = 33/94 (35%), Positives = 42/94 (44%), Gaps = 23/94 (24%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEAD--PC----------- 533 C P+CGSDGKTY NQC + + DL K G C+ + C Sbjct: 5158 CTFEYSPLCGSDGKTYDNQCEMERASCLQNKDL-TGKPGKCDPCEDYTCTSPPYSECTAI 5216 Query: 534 ----------VCTFIYAPVCGTDGNT*PNKCSLE 605 +CT YAPVCGTDG + N+C L+ Sbjct: 5217 NGSPVCTCNSICTLEYAPVCGTDGQSYDNECLLQ 5250 Score = 44.0 bits (99), Expect = 1e-04 Identities = 33/96 (34%), Positives = 44/96 (45%), Gaps = 24/96 (25%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKE-----------------GTCE 518 +C L PVCGSDGK Y N+C L KT++ + +V+ TC+ Sbjct: 5792 SCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDACPGPCSGVTCDSPPYSTCK 5851 Query: 519 EAD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 E D CVC I PV G+DG N+C L+ Sbjct: 5852 EQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 5887 Score = 40.7 bits (91), Expect = 0.001 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSLE 605 P +CTF Y+P+CG+DG T N+C +E Sbjct: 5155 PDICTFEYSPLCGSDGKTYDNQCEME 5180 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTD 572 C L+PV GSDGK Y N+CLL K+ S + I G + T P G Sbjct: 6369 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPKTTTSSATTEAGPCSGVT 6428 Query: 573 GNT*P-NKCSLECSRP 617 ++ P + C ++ +P Sbjct: 6429 CDSPPYSTCKVQDDKP 6444 Score = 39.5 bits (88), Expect = 0.002 Identities = 34/97 (35%), Positives = 42/97 (43%), Gaps = 24/97 (24%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 6081 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 6140 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLECS 611 D CVC I PV G+DG N+C L+ S Sbjct: 6141 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLS 6177 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 +C +PVCGSDGKTY+N+C L K+ S + + +C Sbjct: 5623 SCPSINKPVCGSDGKTYNNECELRQYACKSDSLITVASLSSC 5664 Score = 38.7 bits (86), Expect = 0.004 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 6153 CPEILKPVYGSDGKDYDNECLLKLSACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 6212 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 6213 QDDKPTCVCVEPCPEILKPVYGSDGRDYDNECLLK 6247 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 5385 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 5444 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 5445 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 5479 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 5865 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 5924 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 5925 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 5959 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 5937 CPEILKPVYGSDGKDYDNECLLKLTACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 5996 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 5997 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 6031 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 6009 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 6068 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 6069 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 6103 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 6297 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 6356 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 6357 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 6391 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 6540 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRFPGPCSGVTCDSPPYSTCKV 6599 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 6600 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 6634 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 6612 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 6671 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 6672 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 6706 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTD 572 C+ PVCG+DG+ Y N+C L + + +++ G+C P + + V Sbjct: 5299 CSLVYAPVCGTDGQEYSNECNLQIASCRKNELIEVASRGSCPTTGPSTASPVPTTVDPCS 5358 Query: 573 GNT 581 G T Sbjct: 5359 GVT 5361 Score = 37.5 bits (83), Expect = 0.009 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 537 CTFIYAPVCGTDGNT*PNKCSLECS 611 C+ Y PVCGTDG T N+C+L+ S Sbjct: 5555 CSLDYTPVCGTDGETYENECTLQIS 5579 Score = 37.1 bits (82), Expect = 0.011 Identities = 32/95 (33%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDG+ Y N+CLL K+ S + I G TC+ Sbjct: 6225 CPEILKPVYGSDGRDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 6284 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 6285 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 6319 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C L+PV GSDGK Y N+CLL K+ S + I G Sbjct: 5457 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG 5495 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C L+PV GSDGK Y N+CLL K+ S + I G Sbjct: 6452 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG 6490 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C L+PV GSDGK Y N+CLL K+ S + I G Sbjct: 6684 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG 6722 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 54.8 bits (126), Expect = 5e-08 Identities = 31/88 (35%), Positives = 38/88 (43%), Gaps = 9/88 (10%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLY---CERDKTHSDLKIVKEGTC------EEADP 530 P C RP+CG D KTY N CL C+ K LK+ G C + P Sbjct: 178 PQESQCDLKNRPICGEDEKTYRNLCLFLVAKCKAKKDGRRLKLKYRGACGNPTPRKSCPP 237 Query: 531 CVCTFIYAPVCGTDGNT*PNKCSLECSR 614 C PVCG+DG T N C L ++ Sbjct: 238 RTCPKQDKPVCGSDGKTYTNGCELATAK 265 Score = 49.6 bits (113), Expect = 2e-06 Identities = 33/85 (38%), Positives = 41/85 (48%), Gaps = 11/85 (12%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLY---CERDKTHS-DLKIVKEGTCEE---ADPCV----C 539 C + +PVCGSDGKTY N C L C K L + G C A PC+ C Sbjct: 240 CPKQDKPVCGSDGKTYTNGCELATAKCALPKGQKRQLTLKHRGPCGAPITAKPCMTKQKC 299 Query: 540 TFIYAPVCGTDGNT*PNKCSLECSR 614 PVCG+DG T +KC L ++ Sbjct: 300 RRKRDPVCGSDGVTYRSKCHLRVAK 324 Score = 34.7 bits (76), Expect = 0.061 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLL---YCERD-KTHSDLKIVKEGTC 515 C R PVCGSDG TY ++C L C R K S L + G C Sbjct: 299 CRRKRDPVCGSDGVTYRSKCHLRVAKCLRKRKRRSQLVLKHMGPC 343 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLL---YCERDKTHSDLKIVKEGTCEEADP 530 C R L PVCGSD +Y N C C + L + EG C + P Sbjct: 39 CPRILTPVCGSDRVSYSNMCAFRNAQCLAVEQGQKLLLQYEGECGKPKP 87 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 54.0 bits (124), Expect = 9e-08 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTD 572 C + PVCGSDGKTY N+C L E K + +++I+ C C +Y + Sbjct: 513 CPKEASPVCGSDGKTYENECKLRVESCKANQNVRIISRTKCNACTLSTCNLVYGTCSASS 572 Query: 573 GN 578 N Sbjct: 573 AN 574 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/63 (36%), Positives = 34/63 (53%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTD 572 C R+ RPVCGSD +TY N C L E +T + ++++G C+ C + V D Sbjct: 442 CPRDFRPVCGSDLRTYVNLCRLQVEVCQTGRAVTVLRQGACDPCSVSKCKYNSECVKRAD 501 Query: 573 GNT 581 G+T Sbjct: 502 GST 504 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTF 545 P C LRPVC SDG+TY N+C++ + K+G C+ C F Sbjct: 885 PDKEKCPSELRPVCASDGRTYVNECVMRALACSRKESVNKTKDGACDPCQLVSCRF 940 Score = 45.2 bits (102), Expect = 4e-05 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 23/99 (23%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLY---------------------CERDKTHSDLK 494 P S C+ + PVCGSDGK Y ++C L C R + S + Sbjct: 1289 PRSQECSDVIEPVCGSDGKDYRSRCFLEVTSCALKIKITLKNNGLCVHPCNRTQCPSYSR 1348 Query: 495 IVKEGTCEEADPCV--CTFIYAPVCGTDGNT*PNKCSLE 605 V + + + C C Y P+C ++G T PN+C+L+ Sbjct: 1349 CVLDSSLQAKCVCTKSCPLSYEPLCASNGKTFPNQCALD 1387 Score = 43.6 bits (98), Expect = 1e-04 Identities = 32/91 (35%), Positives = 40/91 (43%), Gaps = 21/91 (23%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-------TCEEADPCV----- 536 C N PVCGS+ KTY N C L E K + +K+ +G TC CV Sbjct: 1826 CRLNYDPVCGSNRKTYLNFCSLTAEACKKNLPIKMAYKGRCCCASTTCGFYSNCVERPNG 1885 Query: 537 ---------CTFIYAPVCGTDGNT*PNKCSL 602 CTF + VCG++G T N C L Sbjct: 1886 QAICVCDEKCTFAFDAVCGSNGRTYINDCLL 1916 Score = 42.7 bits (96), Expect = 2e-04 Identities = 27/77 (35%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = +3 Query: 381 SSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGT---CEEADPCVCTFIY 551 SS C VCG+DG+TY N + CE +L E + C D C + Sbjct: 764 SSSECPSGGASVCGTDGETYEN--MYSCEHVDCSGNLVCKLENSKAVCTCPDVASCDKMP 821 Query: 552 APVCGTDGNT*PNKCSL 602 PVCGTD N+C L Sbjct: 822 DPVCGTDNKEYANECLL 838 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = +3 Query: 381 SSCACARNL----RPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCV 536 +SC+C+ +PVCG+D +T+ N CLL + + SDL + G C DPC+ Sbjct: 1534 ASCSCSSRCPLVYKPVCGTDMETHINACLLKLKSCQIESDLDVAYSGPC-LPDPCL 1588 Score = 41.9 bits (94), Expect = 4e-04 Identities = 34/107 (31%), Positives = 46/107 (42%), Gaps = 28/107 (26%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG---------------T 512 P +C + PVCG+D K Y N+CLL + L+++ +G T Sbjct: 812 PDVASCDKMPDPVCGTDNKEYANECLLNVAACAANIHLRVLNKGPCGGGCALYKCHQFAT 871 Query: 513 CEEADP----CV------CTFIYAPVCGTDGNT*PNKC---SLECSR 614 C EA CV C PVC +DG T N+C +L CSR Sbjct: 872 CNEAPDKTPICVCPDKEKCPSELRPVCASDGRTYVNECVMRALACSR 918 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +3 Query: 381 SSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVC 539 S C A + VCGS+GKTY N+CLL + ++ + +G C+ VC Sbjct: 959 SECPVASSF--VCGSNGKTYTNECLLKVDSCAEQKEISVKHKGACDACSNHVC 1009 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 C + +PVCGSDGK+Y ++C L E + L +V +G C DPC Sbjct: 1686 CPPSGQPVCGSDGKSYGSECELRKEACEAKIKLTLVSKGKC--YDPC 1730 Score = 41.1 bits (92), Expect = 7e-04 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 24/90 (26%) Frame = +3 Query: 414 VCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADP--------CV----------- 536 VCGSDG +Y +C + + D+ + +G C P CV Sbjct: 302 VCGSDGNSYFTECHMDATACRESRDITVKHKGPCGSCSPGSCKFYGVCVGVEDGSMKCVC 361 Query: 537 -----CTFIYAPVCGTDGNT*PNKCSLECS 611 C ++ APVCGTD T P++C ++ S Sbjct: 362 PKPEECPYVNAPVCGTDDRTYPSECIMKTS 391 Score = 41.1 bits (92), Expect = 7e-04 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +3 Query: 381 SSCACARNLR----PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFI 548 +SC C N PVCG DG TY N C L E + ++ + G C+ Sbjct: 575 ASCICPTNCPSDWDPVCGDDGVTYQNLCHLLREACTSGRIIRRLYRGVCD---------- 624 Query: 549 YAPVCGTDGNT*PNKC 596 PVC +DG T N+C Sbjct: 625 --PVCASDGRTYQNEC 638 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTF 545 P+ CA VC SD KTY ++C + E + + L++V+ G C C F Sbjct: 1218 PTLQECAARKGAVCASDMKTYQSECHMRVEACRANKALQVVRRGQCANCASVKCEF 1273 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 414 VCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEE-ADPC 533 VC SDGKTY ++C + + L+++ EG C + ADPC Sbjct: 1082 VCASDGKTYASECHVKVRNCGRYPKLRVIFEGECGQIADPC 1122 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTF 545 +C + P+C S+GKT+ NQC L K + + + G C C + Sbjct: 1364 SCPLSYEPLCASNGKTFPNQCALDMAACKANGSVTFLHTGFCTPCSTVTCLY 1415 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 C VCGS+G+TY N CLL + K + ++++G C Sbjct: 1895 CTFAFDAVCGSNGRTYINDCLLRSDSCKLRKTIVVLQKGAC 1935 Score = 36.7 bits (81), Expect = 0.015 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGK---TYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFI 548 PS C + VCG DGK TY +QC + E + DL++++ G+C+ VC + Sbjct: 688 PSESDCLPAAK-VCGYDGKVMKTYQSQCHMEAEGCRMAKDLQLIRLGSCD-----VCHLV 741 Query: 549 YAPV 560 PV Sbjct: 742 SCPV 745 Score = 35.5 bits (78), Expect = 0.035 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 25/99 (25%) Frame = +3 Query: 381 SSCAC--ARNLR--PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC----------- 515 +SC C R L+ PVCG DGK+Y + C+L + I +G C Sbjct: 1749 ASCQCPECRTLKYTPVCGDDGKSYLSTCMLKRLACLKGVHIAIASKGRCPCKSATCQFGG 1808 Query: 516 ------EEADPCVC-TFI---YAPVCGTDGNT*PNKCSL 602 + + C+C T+ Y PVCG++ T N CSL Sbjct: 1809 RCEIQEDGTEVCICPTYCRLNYDPVCGSNRKTYLNFCSL 1847 Score = 34.7 bits (76), Expect = 0.061 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 411 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCT 542 PVCG+D +TY ++C++ +++ G C VCT Sbjct: 373 PVCGTDDRTYPSECIMKTSACADKKAVRVKHAGECGPCGTLVCT 416 Score = 34.3 bits (75), Expect = 0.080 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLL---YCERDKTHSDLKIVKEGTCEEADPC 533 PS C + VCG+D +Y N+C++ C ++K+ + G C A PC Sbjct: 217 PSESECPLTVDTVCGTDKSSYLNECVMKARACRKEKSVTVAHRGFCGACSLAKPC 271 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYA 554 C+ PVCGSD +Y N+C + + + + EG C C +YA Sbjct: 1150 CSDLNTPVCGSDKVSYRNKCYMIALNCPKNKYVYVKHEGYCAPCRLAECHKVYA 1203 Score = 33.1 bits (72), Expect = 0.19 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +3 Query: 411 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE-EADPCVCTFI-YAPVCGTDGNT* 584 PVC SDG+TY N+CL + DL G C PC Y C G+T Sbjct: 625 PVCASDGRTYQNECLAKKYACEKKRDLTFTL-GKCGLITTPCSARICRYHAKCLYTGSTL 683 Query: 585 PNKCSLE 605 +C E Sbjct: 684 ECRCPSE 690 Score = 33.1 bits (72), Expect = 0.19 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 518 P C NL +CGSDG +Y + C + + + ++ + G CE Sbjct: 1611 PERCPLTYNL--ICGSDGVSYLSACAMRATACQQNRNITVAHHGACE 1655 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 C ++ PVC + G+T+ +C + E + + + G C DPC Sbjct: 150 CPSSMDPVCSTTGETFITKCHMEVEACTESRSMMVARRGEC---DPC 193 Score = 30.7 bits (66), Expect = 0.99 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 537 CTFIYAPVCGTDGNT*PNKCSLE 605 C +Y PVCGTD T N C L+ Sbjct: 1542 CPLVYKPVCGTDMETHINACLLK 1564 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 C ++ PVC + G+T+ +C + E + + + G C Sbjct: 79 CPSSMDPVCSTTGETFITKCHMEVEACTESRSMMVARRGEC 119 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/71 (36%), Positives = 39/71 (54%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTD 572 C+ + PVCGSD TY N+CL+ + ++ + + ++G CE PC T PV GTD Sbjct: 3 CSSTVDPVCGSDNNTYDNECLMRQQACVANTTVAVRRKGDCE---PCPKTL--KPVYGTD 57 Query: 573 GNT*PNKCSLE 605 N+C L+ Sbjct: 58 NKNYDNECLLK 68 Score = 35.1 bits (77), Expect = 0.046 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + L+PV G+D K Y N+CLL K+++ + I G Sbjct: 46 CPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFG 84 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 52.0 bits (119), Expect = 4e-07 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 24/97 (24%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC------------- 533 C PVCG+DGKTY N+C + + + + G CE DPC Sbjct: 1299 CTYEYMPVCGTDGKTYGNKCEMRASACLKSTMVTVAYPGECESNDPCGKRRCGFYAQCEV 1358 Query: 534 -----------VCTFIYAPVCGTDGNT*PNKCSLECS 611 +C Y+PVCG+DGN N+C++ + Sbjct: 1359 VNGSAQCVCPSICPLHYSPVCGSDGNMYSNECAMRAA 1395 Score = 47.6 bits (108), Expect = 8e-06 Identities = 30/81 (37%), Positives = 42/81 (51%), Gaps = 10/81 (12%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDL--KIVKEGTC---EEADPCV-----CT 542 C+ + PVCGSDGK Y + C L ++ L +I TC + CV CT Sbjct: 1759 CSPVISPVCGSDGKIYKDDCELRKTACESRRILLWQIRTLVTCINMNGSAACVCQPRPCT 1818 Query: 543 FIYAPVCGTDGNT*PNKCSLE 605 Y+PVC +DG T PN C+++ Sbjct: 1819 ADYSPVCASDGQTYPNVCTMD 1839 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADP 530 C + PVC SDG+TY N C + + +LK+V+ GTC +P Sbjct: 1817 CTADYSPVCASDGQTYPNVCTMDSAGCQKSMNLKVVRNGTCVRKEP 1862 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 480 HSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLECS 611 ++ ++ +G+ P CT+ Y PVCGTDG T NKC + S Sbjct: 1280 YAQCQVEDDGSTSCKCPIFCTYEYMPVCGTDGKTYGNKCEMRAS 1323 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 25/90 (27%) Frame = +3 Query: 411 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEA-DPC------------------ 533 PVC SDGKTY N+ + + + L+IV +G C +A DPC Sbjct: 1533 PVCASDGKTYPNRMSMENAGCEKNMILRIVSQGECPKAVDPCEITLCDKGKRCLLVNGTA 1592 Query: 534 ------VCTFIYAPVCGTDGNT*PNKCSLE 605 C IY PVC ++G T N+C ++ Sbjct: 1593 TCECFSACPDIYDPVCASNGKTYSNRCDMD 1622 Score = 41.9 bits (94), Expect = 4e-04 Identities = 32/102 (31%), Positives = 42/102 (41%), Gaps = 31/102 (30%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE-----EADP--------- 530 C +N VCGSDG TY N+C L + D+K+ + G C DP Sbjct: 1894 CPKNSSKVCGSDGWTYDNECFLKLYTCRQGKDVKVQQMGECPAKISVSQDPCDISLCTHP 1953 Query: 531 -------------CVC----TFIYAPVCGTDGNT*PNKCSLE 605 CVC T Y PVC +DG PN+ ++E Sbjct: 1954 QHKCRVLVNNTAECVCRTVTTLEYRPVCASDGKIYPNRMTME 1995 Score = 40.3 bits (90), Expect = 0.001 Identities = 33/105 (31%), Positives = 43/105 (40%), Gaps = 34/105 (32%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC---------EEADPC---- 533 C+ N VCGSD TY N+C L + +L +V +G C + DPC Sbjct: 1445 CSANRSDVCGSDRMTYSNECTLTQTACQESKNLTVVSQGPCPPNPKLASGQPLDPCEISL 1504 Query: 534 ---------------VC------TFIYAPVCGTDGNT*PNKCSLE 605 VC T Y PVC +DG T PN+ S+E Sbjct: 1505 CSHPQHTCHNIDNTAVCKCRQMMTADYTPVCASDGKTYPNRMSME 1549 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 AC PVC S+GKTY N+C + + + L +V +G C + C Sbjct: 1599 ACPDIYDPVCASNGKTYSNRCDMDADACIRDTKLTVVSQGACAKLGKC 1646 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPV 560 C + PVCGSDG Y N+C + K + C+ DPC T P+ Sbjct: 1371 CPLHYSPVCGSDGNMYSNECAMRAAACKQQKMITPSLPSKCKLDDPCDVTLCSHPL 1426 Score = 30.7 bits (66), Expect = 0.99 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 408 RPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 518 RPVC SDGK Y N+ + + + L+ V + CE Sbjct: 1978 RPVCASDGKIYPNRMTMENAGCEKNMVLRAVSQDQCE 2014 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSL 602 P +C+ + +PVCG+DG + C L Sbjct: 1756 PSICSPVISPVCGSDGKIYKDDCEL 1780 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 51.2 bits (117), Expect = 7e-07 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 AC R PVCGSDGKTY +C++ + + D+K+ +GTC Sbjct: 50 ACTREYAPVCGSDGKTYPTECVMQVDACSKNKDIKVAFKGTC 91 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 495 IVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 +V++G P CT YAPVCG+DG T P +C ++ Sbjct: 37 VVRDGQPVCECPMACTREYAPVCGSDGKTYPTECVMQ 73 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 4/77 (5%) Frame = +3 Query: 387 CACARN----LRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYA 554 CAC N + PVCG+D TY N+CL+ + ++ + + ++G CE PC T Sbjct: 159 CACPENCSSTVDPVCGTDNNTYDNECLMRQQACVANATVAVRRKGHCE---PCPKTL--K 213 Query: 555 PVCGTDGNT*PNKCSLE 605 PV GTD N+C L+ Sbjct: 214 PVYGTDNKNYDNECLLK 230 Score = 40.3 bits (90), Expect = 0.001 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 23/91 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG----------------TCEEA 524 C + L+PV G+D K Y N+CLL K+++ + I G +C Sbjct: 94 CPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYNPCKDVNCTSPPYSSCRPL 153 Query: 525 D-------PCVCTFIYAPVCGTDGNT*PNKC 596 D P C+ PVCGTD NT N+C Sbjct: 154 DNKPVCACPENCSSTVDPVCGTDNNTYDNEC 184 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Frame = +3 Query: 387 CACARN----LRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 CAC N + PVCGSD TY N+CL+ + ++ + + ++G C Sbjct: 273 CACPENCSSTVDPVCGSDNNTYDNECLMRQQACVANTTVAVRRKGDC 319 Score = 38.7 bits (86), Expect = 0.004 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 23/91 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG----------------TCEEA 524 C + L+PV G+D K Y N+CLL K+++ + I G +C Sbjct: 208 CPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYNPCKDVNCTSPPYSSCRPL 267 Query: 525 D-------PCVCTFIYAPVCGTDGNT*PNKC 596 D P C+ PVCG+D NT N+C Sbjct: 268 DNKPVCACPENCSSTVDPVCGSDNNTYDNEC 298 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCT 542 C + L PVCGSDGKTY+N+CL+ K + ++ + C E P + T Sbjct: 1072 CPKKLMPVCGSDGKTYNNECLMRAASCKANKNITVSSYFPCPETVPPITT 1121 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = +3 Query: 411 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 PVCGSDG Y ++C L + +T +D+ ++ EG C DPC Sbjct: 294 PVCGSDGAQYDSECALQQQACQTDTDITVISEGPC--PDPC 332 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/57 (40%), Positives = 29/57 (50%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVC 563 C L+PV GSDGK Y N+CLL K+ S + I G VCT +A +C Sbjct: 219 CPEILKPVYGSDGKDYDNECLLKLSACKSKSRILIAGFGRYHPCTNAVCTAPFA-IC 274 Score = 39.5 bits (88), Expect = 0.002 Identities = 34/97 (35%), Positives = 42/97 (43%), Gaps = 24/97 (24%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 147 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 206 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLECS 611 D CVC I PV G+DG N+C L+ S Sbjct: 207 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLS 243 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 3 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 62 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 63 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 97 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 75 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 134 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 135 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 169 Score = 36.7 bits (81), Expect = 0.015 Identities = 31/95 (32%), Positives = 43/95 (45%), Gaps = 22/95 (23%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKI-------VKEG--------TCEEAD 527 C++ L+ V GSDGK Y N+CLL T+ + + + EG TC D Sbjct: 1002 CSKILKRVRGSDGKIYDNECLLKLAACTTNKRIILEAFLGPHLCEGVECDAPYATCVSVD 1061 Query: 528 ---PCV----CTFIYAPVCGTDGNT*PNKCSLECS 611 CV C PVCG+DG T N+C + + Sbjct: 1062 GTPTCVCPRRCPKKLMPVCGSDGKTYNNECLMRAA 1096 Score = 35.1 bits (77), Expect = 0.046 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGT 569 AC N R + G+ + C + +S K+ +G P C +Y PV G+ Sbjct: 1402 ACTTNKRIILAGRGRVH--PCAGFSCDSPPYSTCKVQDDGKPSCVCPPKCEKVYDPVYGS 1459 Query: 570 DGNT*PNKCSLE 605 DG N+C L+ Sbjct: 1460 DGKNYDNECELK 1471 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 C ++PVCG+DG TY N C L + ++ + G C Sbjct: 602 CPSEVKPVCGTDGVTYDNLCSLRLKACTDNTRTRFKAFGEC 642 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLL 458 C++ L+ V GSDGK Y N+CLL Sbjct: 515 CSKILKRVRGSDGKIYDNECLL 536 Score = 32.7 bits (71), Expect = 0.25 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 26/97 (26%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKE------------------GTCE 518 C L+ V GSDGK Y N+CLL ++ ++ +I+ E TC+ Sbjct: 692 CPEILKRVRGSDGKIYDNECLL--KQAACTTNKRIIMEAFLGPHPCAGFNCDSPPYSTCK 749 Query: 519 EAD----PCV----CTFIYAPVCGTDGNT*PNKCSLE 605 D CV C +Y PV G+DG N+C L+ Sbjct: 750 VQDDDKPACVCPPKCEKVYDPVYGSDGKNYDNECELK 786 Score = 31.1 bits (67), Expect = 0.75 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 C + PV GSDGK Y N+C L +R S+ +I+ G PC Sbjct: 443 CEKVYDPVYGSDGKNYDNECEL--KRAACTSNRRIILAGR-GRVHPC 486 Score = 30.7 bits (66), Expect(2) = 0.001 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + PV GSDGK Y N+C L +R S+ +I+ G Sbjct: 361 CEKVYDPVYGSDGKNYDNECEL--KRAACTSNRRIILAG 397 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + PV GSDGK Y N+C L +R S+ +I+ G Sbjct: 764 CEKVYDPVYGSDGKNYDNECEL--KRAACTSNRRIILAG 800 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + PV GSDGK Y N+C L +R S+ +I+ G Sbjct: 883 CEKVYDPVYGSDGKNYDNECEL--KRAACTSNRRIILAG 919 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 480 HSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 +S K+ +G P C +Y PV G+DG N+C L+ Sbjct: 1512 YSTCKVQDDGKPSCVCPPKCEKVYDPVYGSDGKNYDNECELK 1553 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLL 458 C + PV GSDGK Y N+C L Sbjct: 1531 CEKVYDPVYGSDGKNYDNECEL 1552 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSL 602 P C PVCGTDG T N CSL Sbjct: 599 PPGCPSEVKPVCGTDGVTYDNLCSL 623 Score = 29.1 bits (62), Expect(2) = 0.001 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 483 SDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 S K+ +G P C +Y PV G+DG N+C L+ Sbjct: 425 STCKVQDDGKPACVCPPQCEKVYDPVYGSDGKNYDNECELK 465 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 480 HSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 +S ++ +G P C +Y PV G+DG N+C L+ Sbjct: 1358 YSTCEVQDDGKPACVCPPKCEKVYDPVYGSDGKNYDNECELK 1399 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSLE 605 P C +Y PV G+DG N+C L+ Sbjct: 880 PPKCEKVYDPVYGSDGKNYDNECELK 905 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 48.8 bits (111), Expect = 3e-06 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEA 524 AC + RPVCG+DGKTY N+C+L ++ +++ EG C+ A Sbjct: 42 ACTKIYRPVCGTDGKTYGNKCVLEIATCESEGAVQLAHEGECDSA 86 Score = 41.9 bits (94), Expect = 4e-04 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 7/50 (14%) Frame = +3 Query: 477 THSDLKIVKEGTCEEADP---CVC----TFIYAPVCGTDGNT*PNKCSLE 605 T + ++ K CEE + CVC T IY PVCGTDG T NKC LE Sbjct: 16 TCATVRCAKYKVCEEVNGIVRCVCNRACTKIYRPVCGTDGKTYGNKCVLE 65 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 48.8 bits (111), Expect = 3e-06 Identities = 34/97 (35%), Positives = 44/97 (45%), Gaps = 24/97 (24%) Frame = +3 Query: 384 SCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG----------TCEEADPC 533 S AC LRP+CGSDGK Y N+C + E + + DLK+ +G +C C Sbjct: 662 SRACPITLRPLCGSDGKNYWNKCHIERESCRYNLDLKVKWQGFCSVSPCSRISCSHYGRC 721 Query: 534 V--------------CTFIYAPVCGTDGNT*PNKCSL 602 V C + PVCGTDG N+C L Sbjct: 722 VVRNNGKAHCVCPRQCQVRFKPVCGTDGREYLNRCFL 758 Score = 47.6 bits (108), Expect = 8e-06 Identities = 24/72 (33%), Positives = 35/72 (48%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTD 572 C +PVCG+DG+ Y N+C L +T + +K+ K G C C F V D Sbjct: 737 CQVRFKPVCGTDGREYLNRCFLRRNACRTQTSIKVHKWGLCNPCKNVECKFKARCVGLPD 796 Query: 573 GNT*PNKCSLEC 608 G+ +C+ EC Sbjct: 797 GSA-VCECNTEC 807 Score = 34.7 bits (76), Expect = 0.061 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEE 521 C PVCG DG+TY + C + + + + + G C + Sbjct: 807 CPSEASPVCGQDGRTYSSTCAMDARACQAQTSIAVKHPGLCRK 849 Score = 30.7 bits (66), Expect = 0.99 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 C+ PVCG D TY N C D+ G C Sbjct: 256 CSHTYSPVCGGDKTTYINNCTRIAAACNMKKDIPFNVNGPC 296 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 474 KTHSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCS 599 K HS G+ P C+ Y+PVCG D T N C+ Sbjct: 235 KFHSRCVKSSGGSANCVCPSDCSHTYSPVCGGDKTTYINNCT 276 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 537 CTFIYAPVCGTDGNT*PNKCSLE 605 C P+CG+DG NKC +E Sbjct: 665 CPITLRPLCGSDGKNYWNKCHIE 687 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 48.8 bits (111), Expect = 3e-06 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 23/94 (24%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE---------------EA- 524 C +L VCG+D TY N+CL+ + +T+S LK+ ++G C+ EA Sbjct: 1513 CPASLDLVCGTDNITYSNECLMKYQACRTNSALKVKRKGDCDVCKDFDCSSAPYSSCEAV 1572 Query: 525 -------DPCVCTFIYAPVCGTDGNT*PNKCSLE 605 P +C PVC +D NT PN+C+++ Sbjct: 1573 NDKPICVCPKICPITLDPVCASDNNTYPNECAMK 1606 Score = 45.2 bits (102), Expect = 4e-05 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFI 548 C +P+C SDG+TY N+CL+ + + +L + + C DP F+ Sbjct: 2158 CTNETKPICASDGQTYDNECLMQKRACENNQNLNVTSDRACPCKDPVDLAFV 2209 Score = 44.4 bits (100), Expect = 8e-05 Identities = 34/101 (33%), Positives = 45/101 (44%), Gaps = 26/101 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLL-----------------YCERDKTHSDLKIVKEGTCEE 521 C + L+PVCGSD Y N+CL+ YC+ K HS TC+ Sbjct: 1377 CPKTLKPVCGSDNNDYDNECLMQARACATNKTITAHRNGYCDPCKNHS-CSTPPYSTCKA 1435 Query: 522 AD---PCVCTFIYAP----VCGTDGNT*PNKCSL--ECSRP 617 D CVC+ + VCGTD T N+C L + +RP Sbjct: 1436 VDDKAECVCSKVCPRSLDLVCGTDNITYNNECFLKRQAARP 1476 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 C + ++ VCGSDGKTY N+C+L +++ L + EG C Sbjct: 1653 CPKIVKQVCGSDGKTYDNECVLRMAACESNRTLAVRNEGNC 1693 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Frame = +3 Query: 387 CACARN----LRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 CAC N + PVCGSD TY N+CL+ + ++ + + ++G C DPC Sbjct: 1204 CACPENCSSTVDPVCGSDNNTYDNECLMRQQACVANTTVAVRRKGDC---DPC 1253 Score = 41.9 bits (94), Expect = 4e-04 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 4/79 (5%) Frame = +3 Query: 387 CACARN----LRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYA 554 CAC N + PVCG+D TY N+CL+ + ++ + + ++G C+ CT Sbjct: 1133 CACPENCSSTVDPVCGTDNNTYDNECLMRQQACVANATVAVRRKGHCDPCKDVNCTSPPY 1192 Query: 555 PVCGTDGNT*PNKCSLECS 611 C N C CS Sbjct: 1193 SSCRPLDNKPVCACPENCS 1211 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/75 (26%), Positives = 36/75 (48%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGT 569 +C L PVCGSD ++Y N C L + + S + +++ C+ +C+ Y+ C Sbjct: 1723 SCPNTLDPVCGSDLQSYDNVCFLRMQSCQQISLITVLRPNYCDPCQNFICSAPYSS-CEV 1781 Query: 570 DGNT*PNKCSLECSR 614 N +C +C + Sbjct: 1782 KDNEAVCECPKDCPK 1796 Score = 40.3 bits (90), Expect = 0.001 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 23/91 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG----------------TCEEA 524 C + L+PV G+D K Y N+CLL K+++ + I G +C Sbjct: 1068 CPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYNPCKDVNCTSPPYSSCRPL 1127 Query: 525 D-------PCVCTFIYAPVCGTDGNT*PNKC 596 D P C+ PVCGTD NT N+C Sbjct: 1128 DNKPVCACPENCSSTVDPVCGTDNNTYDNEC 1158 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 518 AC L PVCGSDG TY ++C + + +T++ + +V C+ Sbjct: 2628 ACKPTLTPVCGSDGVTYESECGMIQKACQTNTSITLVANEACK 2670 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 C++ PVCGSD KTY N+C + E + + + ++ EE DPC Sbjct: 612 CSKREDPVCGSDSKTYPNECRMRQEACWNNKWIIVAQQ---EECDPC 655 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 PSSC +P+CGS+ KTY N+C L + K + + I C PC Sbjct: 290 PSSCGDESLPQPICGSNNKTYANECELRMDSCKNNKSIAIQFRKECPA--PC 339 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 C + +PVCG++ KTY ++C L + KT++ + + + C E PC Sbjct: 682 CPQVDKPVCGTNNKTYTSECALQVDACKTNTSIDVQLDKPCPE--PC 726 Score = 37.5 bits (83), Expect = 0.009 Identities = 32/91 (35%), Positives = 37/91 (40%), Gaps = 21/91 (23%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCL---LYCERDKT-----HSDLKIVKE-------GTCEEAD 527 C L PVC SD TY N+C L C+ K D + TCE D Sbjct: 1584 CPITLDPVCASDNNTYPNECAMKQLACQSAKVLTFRRKGDCDPCNDFDCTAPYSTCEAKD 1643 Query: 528 P---CV---CTFIYAPVCGTDGNT*PNKCSL 602 CV C I VCG+DG T N+C L Sbjct: 1644 DKAVCVCPKCPKIVKQVCGSDGKTYDNECVL 1674 Score = 35.5 bits (78), Expect = 0.035 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 17/91 (18%) Frame = +3 Query: 384 SCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEAD----PCVCTFI- 548 S C R+L VCG+D TY+N+C L + + + L+ + T A+ P + T Sbjct: 1445 SKVCPRSLDLVCGTDNITYNNECFLKRQAARPIARLRSDERATVTRANCTNAPLLRTLFA 1504 Query: 549 -------YAP-----VCGTDGNT*PNKCSLE 605 Y P VCGTD T N+C ++ Sbjct: 1505 KLWLTSQYCPASLDLVCGTDNITYSNECLMK 1535 Score = 35.1 bits (77), Expect = 0.046 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + L+PV G+D K Y N+CLL K+++ + I G Sbjct: 1281 CPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFG 1319 Score = 34.3 bits (75), Expect = 0.080 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCV 536 C + VCG++ KTY N+C++ + +S + + G C DPCV Sbjct: 1794 CPKEDAEVCGTNWKTYTNECMMRKQACMNNSMVTVRSIGRC---DPCV 1838 Score = 31.9 bits (69), Expect = 0.43 Identities = 23/70 (32%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Frame = +3 Query: 417 CGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADP-----CVCTFIYA---PVCGTD 572 C D K H+ C C + DL TCE P C C PVCG+D Sbjct: 566 CLDDLKCCHSGCHKQCVKPNQVVDLS--PYATCEANVPSGKISCTCPECSKREDPVCGSD 623 Query: 573 GNT*PNKCSL 602 T PN+C + Sbjct: 624 SKTYPNECRM 633 Score = 31.5 bits (68), Expect = 0.57 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCT 542 C PVCGSD TY ++C L + + ++G C+ CT Sbjct: 222 CKDKSDPVCGSDNVTYASECQLRRAACLNDTWITTQRKGDCDVCKDVSCT 271 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 504 EGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 + TCE ++ C T PVCG+D N N+C ++ Sbjct: 1368 KATCECSEDCPKTL--KPVCGSDNNDYDNECLMQ 1399 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 47.6 bits (108), Expect = 8e-06 Identities = 21/44 (47%), Positives = 26/44 (59%) Frame = +3 Query: 384 SCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 S AC R PVCGSDG TY+N CLL R ++ + + GTC Sbjct: 725 SAACTREYAPVCGSDGNTYNNLCLLTAARCQSQTFIYRAHFGTC 768 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 4/66 (6%) Frame = +3 Query: 387 CACARNLR----PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYA 554 C C R+ PVCG DG+TY N+CLL E + V G+C + P V F Sbjct: 971 CECPRSCPSVNYPVCGDDGQTYDNECLLQLESCSRRRSITTVNYGSCGQQQP-VHLFFAI 1029 Query: 555 PVCGTD 572 G+D Sbjct: 1030 DARGSD 1035 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +3 Query: 537 CTFIYAPVCGTDGNT*PNKCSLECSR 614 CT YAPVCG+DGNT N C L +R Sbjct: 728 CTREYAPVCGSDGNTYNNLCLLTAAR 753 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 26/90 (28%) Frame = +3 Query: 411 PVCGSDGKTYHNQ-------CLLY----------CERDKTHSDLK-------IVKEG--T 512 P+CG+DGKTY+N C C + + ++L+ IV++G Sbjct: 1245 PICGTDGKTYNNDKDLESAACAQQTSIVRWHKGPCTVEPSCANLQCKYYSYCIVRDGGAV 1304 Query: 513 CEEADPCVCTFIYAPVCGTDGNT*PNKCSL 602 C DP C + + VCGTDG T N C L Sbjct: 1305 CTCPDPAACPLVKSRVCGTDGITYDNLCRL 1334 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 P AC VCG+DG TY N C L E + + + ++ G C Sbjct: 1308 PDPAACPLVKSRVCGTDGITYDNLCRLRAESCRRYQPVNVLHSGYC 1353 Score = 31.1 bits (67), Expect = 0.75 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSLE---CSR 614 P C + PVCG DG T N+C L+ CSR Sbjct: 974 PRSCPSVNYPVCGDDGQTYDNECLLQLESCSR 1005 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSD--LKIVKEGTC 515 C R+ + VCGSD + Y N+C+L R T D L + +G C Sbjct: 1566 CPRSDQLVCGSDDRDYANECVLQA-RACTWRDSLLTVHNKGPC 1607 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 45.6 bits (103), Expect = 3e-05 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 21/92 (22%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE--EADPC---------- 533 +C + +PVCGS+GK Y+N+C L KT++ + + + C + PC Sbjct: 207 SCPKMNKPVCGSNGKDYNNECELQQFACKTNTMITVARRSPCHPCQTSPCSAPYAKCLVV 266 Query: 534 ----VCTFIYA-----PVCGTDGNT*PNKCSL 602 VCT + PVCG+DG N C L Sbjct: 267 QGEAVCTCLSCPNMLDPVCGSDGKNYDNVCKL 298 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 +C L PVCGSDGK Y N+C L KT++ + +V+ C Sbjct: 113 SCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDAC 154 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGT 569 +C L PVCGSDGK Y N C L KT++ + ++ C + T Sbjct: 276 SCPNMLDPVCGSDGKNYDNVCKLRQNACKTNTLITLISRDACPFTEARFTPPSQNKARTT 335 Query: 570 DGNT*PNKCS-LECSRP 617 G T CS + C P Sbjct: 336 SGPTTAGPCSNVTCDSP 352 Score = 40.7 bits (91), Expect = 0.001 Identities = 33/95 (34%), Positives = 42/95 (44%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C + L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 372 CPKILKPVYGSDGKNYDNECLLKLAACKSKSRILIAGSGRYPGPCSGVTCDSPPYSTCKV 431 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 432 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 466 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 444 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 503 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 504 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 538 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C L+PV GSDGK Y N+CLL K+ S + I G Sbjct: 516 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG 554 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 537 CTFIYAPVCGTDGNT*PNKCSL 602 C I PVCG+DG N+C+L Sbjct: 114 CPNILDPVCGSDGKNYDNECNL 135 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 45.6 bits (103), Expect = 3e-05 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 16/90 (17%) Frame = +3 Query: 375 LPSSC--ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFI 548 LP+ C C PVCG+D +TY ++C L + K H +K++ +G C+E C+ ++ Sbjct: 202 LPNRCHEPCPSEASPVCGTDMRTYASRCHLQLAKCKGHK-VKMIYKGRCKEIKRCIGEYL 260 Query: 549 --------------YAPVCGTDGNT*PNKC 596 Y P C +DG+ P +C Sbjct: 261 AALRSPQQSPSGQSYLPKCQSDGSFVPMQC 290 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 AC + P+CG+DGKTY N+C+L ++ +K+ EG C Sbjct: 42 ACKKIYSPMCGTDGKTYGNKCMLEIATCESEGAVKLAHEGEC 83 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = +3 Query: 537 CTFIYAPVCGTDGNT*PNKCSLE 605 C IY+P+CGTDG T NKC LE Sbjct: 43 CKKIYSPMCGTDGKTYGNKCMLE 65 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +3 Query: 378 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 P CA C + +PVCGSD TY N C+L K++ + + G C + C Sbjct: 23 PDKCAPICNKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSQSC 76 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 525 DPC--VCTFIYAPVCGTDGNT*PNKCSL 602 D C +C +Y PVCG+D T N C L Sbjct: 24 DKCAPICNKMYQPVCGSDNVTYSNPCML 51 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = +3 Query: 384 SCACARNL----RPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 +C C +N +PVCGSDGKTY N+C L ++ ++ + +G C Sbjct: 3967 TCVCNKNCPSTSKPVCGSDGKTYKNECELKRAACESKKNVTVASQGEC 4014 Score = 36.3 bits (80), Expect = 0.020 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQC-LLYCERDKTHSDLKIVKEGTCE 518 C + PVCG+DGKTY N C + + H D + K+G CE Sbjct: 4241 CLPDKEPVCGADGKTYRNLCEIRKASCEGWHRDNR-RKQGICE 4282 Score = 34.7 bits (76), Expect = 0.061 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGT 569 AC N R + G+ + C + +S K+ +G P C +Y PV G+ Sbjct: 250 ACTTNKRIILAGRGRVH--PCAGFSCDSPPYSTCKVQDDGKPACVCPPKCEKVYDPVYGS 307 Query: 570 DGNT*PNKCSLE 605 DG N+C L+ Sbjct: 308 DGKNYDNECELK 319 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 480 HSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 +S K+ +G P C +Y PV G+DG N+C L+ Sbjct: 206 YSTCKVQDDGKPACVCPPKCEKVYDPVYGSDGKNYDNECELK 247 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 462 CERDKTHSDLKIVK-EGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 C + +S + V + TC C T PVCG+DG T N+C L+ Sbjct: 3950 CAEKRPYSTCQAVNGQPTCVCNKNCPSTS--KPVCGSDGKTYKNECELK 3996 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 378 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 P CA C + RPVCGSD TY N C+L K++ + + G C Sbjct: 37 PDKCAPICPKIYRPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKC 84 Score = 30.7 bits (66), Expect = 0.99 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 525 DPC--VCTFIYAPVCGTDGNT*PNKCSL 602 D C +C IY PVCG+D T N C L Sbjct: 38 DKCAPICPKIYRPVCGSDNVTYSNPCML 65 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/47 (44%), Positives = 24/47 (51%) Frame = +3 Query: 381 SSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEE 521 S C PVCGSDGKTY N C L K + DL + +G C E Sbjct: 28 SPTLCTLQYDPVCGSDGKTYGNMCFLKA-AIKCNPDLYMKHKGACPE 73 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +3 Query: 513 CEEADPCVCTFIYAPVCGTDGNT*PNKCSLECS 611 C+++ P +CT Y PVCG+DG T N C L+ + Sbjct: 25 CDDS-PTLCTLQYDPVCGSDGKTYGNMCFLKAA 56 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Frame = +3 Query: 387 CACARN----LRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVC 539 CAC N + PVCG+D TY N+CL+ + ++ + + ++G C+ C Sbjct: 25 CACPENCSSTVDPVCGTDNNTYDNECLMRQQACVANATVAVRRKGHCDPCSKVTC 79 Score = 35.1 bits (77), Expect = 0.046 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + L+PV G+D K Y N+CLL K+++ + I G Sbjct: 102 CPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFG 140 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 522 ADPCVCTFIYAPVCGTDGNT*PNKC 596 A P C+ PVCGTD NT N+C Sbjct: 26 ACPENCSSTVDPVCGTDNNTYDNEC 50 >SB_44627| Best HMM Match : Kazal_1 (HMM E-Value=3.19496e-43) Length = 260 Score = 39.5 bits (88), Expect = 0.002 Identities = 34/97 (35%), Positives = 42/97 (43%), Gaps = 24/97 (24%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 75 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 134 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLECS 611 D CVC I PV G+DG N+C L+ S Sbjct: 135 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLS 171 Score = 38.7 bits (86), Expect = 0.004 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 147 CPEILKPVYGSDGKDYDNECLLKLSACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 206 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 207 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 241 Score = 38.3 bits (85), Expect = 0.005 Identities = 33/95 (34%), Positives = 41/95 (43%), Gaps = 24/95 (25%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG-----------------TCEE 521 C L+PV GSDGK Y N+CLL K+ S + I G TC+ Sbjct: 3 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSGVTCDSPPYSTCKV 62 Query: 522 AD---PCVCT----FIYAPVCGTDGNT*PNKCSLE 605 D CVC I PV G+DG N+C L+ Sbjct: 63 QDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLK 97 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C L+PV GSDGK Y N+CLL K+ S + I G Sbjct: 219 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG 257 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 A + PVCGSDG+TY N+ + + ++ LKIV +G C Sbjct: 13 AVTADYNPVCGSDGRTYPNRASMEVQGCLKNTVLKIVSQGEC 54 Score = 34.7 bits (76), Expect = 0.061 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSLE 605 P T Y PVCG+DG T PN+ S+E Sbjct: 11 PMAVTADYNPVCGSDGRTYPNRASME 36 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 518 C +++PVCGSDG TY N C L+ + I +G CE Sbjct: 85 CPDHIKPVCGSDGVTYPNHCELHRIACVHTKKITIRSKGPCE 126 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 555 PVCGTDGNT*PNKCSL 602 PVCG+DG T PN C L Sbjct: 91 PVCGSDGVTYPNHCEL 106 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 37.5 bits (83), Expect = 0.009 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 411 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 PVCG+DGKTY N+C+L ++ + + G C Sbjct: 34 PVCGTDGKTYGNECMLGAATCHSNGTITLAYPGEC 68 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 519 EADPCV--CTFIYAPVCGTDGNT*PNKCSL 602 + D CV C I PVCGTDG T N+C L Sbjct: 20 QVDKCVRPCPAINDPVCGTDGKTYGNECML 49 >SB_25348| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) Length = 73 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C L+PV GSDGK Y N+CLL K+ S + I G Sbjct: 32 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG 70 >SB_14008| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) Length = 73 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C L+PV GSDGK Y N+CLL K+ S + I G Sbjct: 32 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG 70 >SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 36.3 bits (80), Expect = 0.020 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Frame = +3 Query: 378 PSSCACA-RNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYA 554 P+S C L PVC +DG+ + N C L+ + K+ +G C+ C Sbjct: 179 PASSYCKDMQLEPVCDTDGQQHPNLCSLHFQ------GKKLAYKGFCKS----YCKSPTK 228 Query: 555 PVCGTDGNT*PNKCSLECSR 614 PVCG +G T + C +R Sbjct: 229 PVCGVNGETYSSICGAHSAR 248 >SB_7990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 16 WAKGQPDNQFSRQKQNCGGM-FRDATLDDTLCDDHLAFICEK 138 W G+P+N SR +NC M + D +D LC + ++CEK Sbjct: 109 WGYGEPNNYMSR-GENCSEMRYWDGMWNDVLCVNKYGYVCEK 149 >SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 35.1 bits (77), Expect = 0.046 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGT 569 AC N R + G+ + C + +S K+ +G P C +Y PV G+ Sbjct: 549 ACTTNKRIILAGRGRVH--PCAGFSCDSPPYSTCKVQDDGKPSCVCPPKCEKVYDPVYGS 606 Query: 570 DGNT*PNKCSLE 605 DG N+C L+ Sbjct: 607 DGKNYDNECELK 618 Score = 34.7 bits (76), Expect = 0.061 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +3 Query: 390 ACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVCGT 569 AC N R + G+ + C + +S K+ +G P C +Y PV G+ Sbjct: 176 ACTSNRRIILAGRGRVH--PCAGFSCDSPPYSTCKVQDDGKPACVCPPKCEKVYDPVYGS 233 Query: 570 DGNT*PNKCSLE 605 DG N+C L+ Sbjct: 234 DGKNYDNECELK 245 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + PV GSDGK Y N+C L +R S+ +I+ G Sbjct: 32 CEKVYDPVYGSDGKNYDNECEL--KRAACTSNRRIILAG 68 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 480 HSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 +S K+ +G P C +Y PV G+DG N+C L+ Sbjct: 659 YSTCKVQDDGKPSCVCPPKCEKVYDPVYGSDGKNYDNECELK 700 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLL 458 C + PV GSDGK Y N+C L Sbjct: 678 CEKVYDPVYGSDGKNYDNECEL 699 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 480 HSDLKIVKEGTCEEADPCVCTFIYAPVCGTDGNT*PNKCSLE 605 +S ++ +G P C +Y PV G+DG N+C L+ Sbjct: 505 YSTCEVQDDGKPACVCPPKCEKVYDPVYGSDGKNYDNECELK 546 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSLE 605 P C +Y PV G+DG N+C L+ Sbjct: 29 PPKCEKVYDPVYGSDGKNYDNECELK 54 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSLE 605 P C +Y PV G+DG N+C L+ Sbjct: 148 PPKCEKVYDPVYGSDGKNYDNECELK 173 >SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 34.7 bits (76), Expect = 0.061 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 381 SSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPC 533 SSC + VCG+DG TY + C L K + + G+C+E C Sbjct: 132 SSCNSSPADTEVCGADGVTYGSLCRLRVATCKLGKTIGVAYLGSCKEGSDC 182 >SB_22525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 674 Score = 34.3 bits (75), Expect = 0.080 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 381 SSCACAR-NLRPVCGSDGKTYHNQCLLYCE 467 S+C C+ RPVCG DG +Y++ C C+ Sbjct: 462 SACHCSTAQFRPVCGPDGVSYYSPCFAGCK 491 >SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) Length = 396 Score = 32.7 bits (71), Expect = 0.25 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 417 CGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 518 CGSDG TY N CL +T ++ IV G C+ Sbjct: 33 CGSDGVTYKNDCLYKKYICETRLNVTIVHLGACQ 66 >SB_42813| Best HMM Match : Lectin_C (HMM E-Value=4.8e-21) Length = 276 Score = 31.9 bits (69), Expect = 0.43 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = +1 Query: 1 AGYAKWAKGQPDNQFSRQKQNCGGM-FR---DATLDDTLCDDH--LAFICEKDPKKL 153 A + KWAKG+P+N + ++C M FR + + +D LC + +IC+ P L Sbjct: 208 AKFFKWAKGEPNN-YQGNTEDCVAMDFRSLSNGSYNDVLCQESSVSGYICKGSPMPL 263 >SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 31.9 bits (69), Expect = 0.43 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 417 CGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 518 CGSDG TY N CL +T ++ IV G C+ Sbjct: 187 CGSDGVTYKNDCLYKKYICETRLNVTIVHLGGCQ 220 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 31.5 bits (68), Expect = 0.57 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVK 503 C +PV SDG Y N+CL+ + D+ +V+ Sbjct: 963 CPNTGQPVLASDGAQYDNECLMQLNACSANKDITVVE 999 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 4/29 (13%) Frame = +3 Query: 384 SCACARN----LRPVCGSDGKTYHNQCLL 458 +CAC L PV GSD Y N+CL+ Sbjct: 872 TCACTMQCPSLLDPVVGSDNVMYMNECLM 900 >SB_27078| Best HMM Match : Kazal_2 (HMM E-Value=7.6e-07) Length = 54 Score = 31.1 bits (67), Expect = 0.75 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 555 PVCGTDGNT*PNKCSL 602 PVCGTDGN P++C L Sbjct: 13 PVCGTDGNDYPSRCKL 28 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 387 CACARNLRPVCGSDGKTYHNQCLL---YCERDKTHSDLKIVKEGTCEE 521 C + PVCG+DG Y ++C L C ++K LK+ G+C + Sbjct: 5 CGDEKEAFPVCGTDGNDYPSRCKLRYQACMQNKL-GLLKVKCGGSCAD 51 >SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 381 SSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEE 521 S+C+ A+ +C SDG TY+++C L S + ++ G C++ Sbjct: 51 STCSPAQPSDRLCASDGITYNSKCELNKTACLLGSSITVLYRGACDK 97 >SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) Length = 711 Score = 30.7 bits (66), Expect = 0.99 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 411 PVCGSDGKTYHNQC-LLYCERDKTHSDLKIVKEGTCEEADPC 533 PVCG D TY + C +C + D+ + +G C+ +PC Sbjct: 313 PVCGPDWTTYRSLCHARFC----GNYDIDEIVQGPCQNIEPC 350 Score = 30.3 bits (65), Expect = 1.3 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = +3 Query: 375 LPSSCACARNLRP---VCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTF 545 +P C+ ++ P VCG DG +Y ++C + HS + G C E C Sbjct: 389 VPIDQTCSEDVLPKDMVCGEDGVSYPSECGMI-----KHS-VTFAYRGPCRE----TCQQ 438 Query: 546 IYAPVCGTDGNT*PNKC 596 + VC TDG T + C Sbjct: 439 GNSQVCSTDGVTLQSPC 455 >SB_5272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEG 509 C + PV GSDGK Y N+C L +R S+ +I+ G Sbjct: 64 CEKVYDPVYGSDGKNYDNECEL--KRAACTSNRRIILAG 100 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSLE 605 P C +Y PV G+DG N+C L+ Sbjct: 61 PPKCEKVYDPVYGSDGKNYDNECELK 86 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 30.7 bits (66), Expect = 0.99 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 381 SSCACARN-LRPVCGSDGKTYHNQCLLYC 464 + CAC ++ PVCG+D TY C C Sbjct: 133 ADCACVKSQFNPVCGADDVTYFTPCHAGC 161 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 384 SCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIV 500 SC + PVCGSD TY N C L ER+ +D+ V Sbjct: 11 SCDDGFHQTPVCGSDDVTYANACTL-DERNCRATDMGYV 48 >SB_55359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2516 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +1 Query: 7 YAKWAKGQPDNQFSRQKQNCGGMFRDATLDDTLCDDHLAFICE 135 Y W +G+P+N F + +++D +D C +FIC+ Sbjct: 73 YTNWRRGEPNN-FQDNEDCTELLYQDGLWNDDDCSKEYSFICK 114 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +1 Query: 7 YAKWAKGQPDNQFSRQKQNCGGMFRDAT---LDDTLCDDHLAFICEK 138 Y+ W G+P++ S ++C M+ + +D CD A++CEK Sbjct: 207 YSHWYSGEPNDHAS--VEDCISMYSGSLGGFWNDDYCDTLRAYVCEK 251 >SB_58330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 631 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 4 GYAKWAKGQPDNQFSRQKQNCGGMFRDAT---LDDTLCDDHLAFICE 135 G WA GQP + + Q+++C M + D C + L FIC+ Sbjct: 346 GRPNWAPGQPTGRSNGQEKDCVAMVMHPSPGKWHDEYCLNQLPFICK 392 >SB_12293| Best HMM Match : OATP (HMM E-Value=0) Length = 1446 Score = 29.1 bits (62), Expect = 3.0 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +3 Query: 387 CACAR-NLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTFIYAPVC 563 C C+ + PVCG D TY + C C++ + GT EE D C+C I V Sbjct: 903 CQCSSTDYFPVCGVDKITYFSPCYAGCQK----------RIGT-EEFDKCLC--IQPAVE 949 Query: 564 GTD-GNT*PNKCSLEC 608 GT+ G C +C Sbjct: 950 GTEFGFAKKGVCDRDC 965 >SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) Length = 1042 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +3 Query: 393 CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTC 515 C + VCG++G+T+ N CL + + + G+C Sbjct: 219 CPAYIDQVCGTNGQTFDNLCLFKKHVCRIKGNFSYLHHGSC 259 >SB_3993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 543 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 398 KKLKTGLRIRRQDLPQPVPLVLREGQDAQRFENRER 505 KKLK+ R++R D P+P P + +DA NR R Sbjct: 446 KKLKSAERVKRCDSPKPSP-SSSDNEDADATFNRSR 480 >SB_8855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +1 Query: 94 DDTLCDDHLAFICEKD-PKKLQTAKIAPRT 180 +D CD +ICEKD PK++ AP T Sbjct: 210 NDNSCDHQQGYICEKDKPKEVLATGDAPHT 239 >SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 513 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +2 Query: 125 LFVKKTRRSYKRLR*LLEPL--DSESCNYILKRYSSLF 232 +FVK+ R+SYK L+ E L DS S + + R ++LF Sbjct: 117 IFVKEIRKSYKNLKTRSELLCGDSHSSSRFIHRMTNLF 154 >SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) Length = 217 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 528 PCVCTFIYAPVCGTDGNT*PNKCSL 602 P C Y PVC G PNKC L Sbjct: 38 PVSCPNTYEPVCSVYGIQFPNKCEL 62 >SB_11598| Best HMM Match : Kazal_2 (HMM E-Value=2.1e-05) Length = 79 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 518 P SC + C +DGKTY N C T +++K+ G+CE Sbjct: 35 PKSCPVYQE--EYCANDGKTYSNMCEYDQMVCNTGNEIKL-HPGSCE 78 >SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 378 PSSCACARNLRPVCGSDGKTYHNQC 452 P +CA N R CG D TY N+C Sbjct: 301 PHNCATYENQR--CGEDNVTYTNEC 323 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,286,136 Number of Sequences: 59808 Number of extensions: 356513 Number of successful extensions: 1159 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1136 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -