BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O02 (545 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD... 35 1.1 UniRef50_Q70GV4 Cluster: Putative uncharacterized protein fp9.20... 35 1.4 UniRef50_Q3LW59 Cluster: Putative uncharacterized protein; n=1; ... 33 4.3 UniRef50_O97234 Cluster: Putative uncharacterized protein MAL3P2... 33 4.3 UniRef50_Q8I3K5 Cluster: Putative uncharacterized protein PFE129... 32 9.9 >UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD protein - Plasmodium falciparum Length = 960 Score = 35.1 bits (77), Expect = 1.1 Identities = 23/65 (35%), Positives = 34/65 (52%) Frame = -3 Query: 264 NVYSGNIRFELSWK*YTTC*QV*CKMYKNLKYTYFYKLFYINVI*YTRNKIILNYFHHIH 85 N+Y +I FEL K +C ++ +K KY L IN+I Y+ N LN H+I+ Sbjct: 836 NIYLPSIYFELIIKKMLSCIKIISNNFKIFKYNDIISLQLINIINYSLN---LNK-HYIY 891 Query: 84 MYVPV 70 Y P+ Sbjct: 892 KYEPI 896 >UniRef50_Q70GV4 Cluster: Putative uncharacterized protein fp9.205; n=2; Fowlpox virus|Rep: Putative uncharacterized protein fp9.205 - Fowlpox virus (isolate HP-438[Munich]) Length = 218 Score = 34.7 bits (76), Expect = 1.4 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +3 Query: 168 YILNSYTFYIILVNMLCITSTIIQIVCYRCIHLQFIDKKTPLSKFLEEFV 317 + LN+Y Y ++++ +C+ II IVCY ++I+KK E+F+ Sbjct: 145 HFLNNYQLYTLVLSSICVVIIII-IVCYISYKHKYINKKIKTISNSEKFI 193 >UniRef50_Q3LW59 Cluster: Putative uncharacterized protein; n=1; Bigelowiella natans|Rep: Putative uncharacterized protein - Bigelowiella natans (Pedinomonas minutissima) (Chlorarachnion sp.(strain CCMP 621)) Length = 100 Score = 33.1 bits (72), Expect = 4.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 121 KQNNIKLFSSYSYVCTCYK*SINNFMRHIITKKKKKN 11 KQN KL +C CY ++F++H+ KK K+N Sbjct: 42 KQNIFKLSKFDCTICKCYLWDSDSFLKHLTGKKHKRN 78 >UniRef50_O97234 Cluster: Putative uncharacterized protein MAL3P2.13; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL3P2.13 - Plasmodium falciparum (isolate 3D7) Length = 1446 Score = 33.1 bits (72), Expect = 4.3 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -3 Query: 195 CK-MYKNLKYTYFYKLFYINVI*YTRNKIILNYFHHIHMY 79 CK +Y+ T+FYKL Y+++ K+ N+F HIH+Y Sbjct: 285 CKDLYEEAIITHFYKLKYLDI-----QKLYNNHFFHIHIY 319 >UniRef50_Q8I3K5 Cluster: Putative uncharacterized protein PFE1295c; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFE1295c - Plasmodium falciparum (isolate 3D7) Length = 806 Score = 31.9 bits (69), Expect = 9.9 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 141 LYKTIYKNKYILNSYTFYIILVNMLCITSTIIQIVCYRCIHL-QFIDKKTPLSKFLEEFV 317 +Y TI KNKY N IIL+N I I +C+HL + D K+L F Sbjct: 511 IYNTILKNKYNHNEPNIKIILINF--NNKNIHYIYDNKCVHLNSYYDYLFKRLKYLLHFY 568 Query: 318 R 320 R Sbjct: 569 R 569 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 438,761,210 Number of Sequences: 1657284 Number of extensions: 7572481 Number of successful extensions: 15576 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15562 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 35405708495 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -