BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_O01 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 25 0.46 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.5 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 25.0 bits (52), Expect = 0.46 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +2 Query: 41 RTTN*YATIM-AVDLNEIGAQKVKNVANGEISELKSFWEDQNAAIIFFRRWGCMLCRLW 214 R+ N + I VD + + ++K + + + +K E++N FR +GC L +W Sbjct: 23 RSVNIFQDIADCVDRSNMTFHELKKLRDSSEARIKLINEEEN-----FRNYGCFLACIW 76 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 7.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 158 DLPKKISVPKFLHSPHSSLFEHQFHLNPRPLSLRINL 48 D+P ++ + K H+P+ + H P SLRI L Sbjct: 782 DVPIELQIQKQSHTPNGIVKTWIAHDRYLPNSLRILL 818 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,584 Number of Sequences: 438 Number of extensions: 3371 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -