BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N22 (152 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0657 + 5674907-5674993,5675615-5676583 26 3.6 04_04_0590 + 26457514-26457801,26458849-26459325,26459817-264600... 25 8.3 >08_01_0657 + 5674907-5674993,5675615-5676583 Length = 351 Score = 26.2 bits (55), Expect = 3.6 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 16 SSWLPSLNRKKLELLGGTCDLAIAVKDAIFVQECVPENL 132 S+W+ L R LE G D A V+ I V +P+N+ Sbjct: 111 SAWVLILRRSALEASGAIVDDAFTVECTITVITEIPDNV 149 >04_04_0590 + 26457514-26457801,26458849-26459325,26459817-26460027, 26460219-26460376,26460461-26460531,26460707-26460812, 26460880-26460966,26461591-26462148,26462245-26462308, 26463352-26463485,26463568-26463621,26464321-26464417, 26465620-26465825,26465901-26465984,26466265-26466330, 26466883-26466956,26467664-26467751,26467830-26467928 Length = 973 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 59 NNSNFFRFKLGSHDDT 12 +NSN FR+ GS DDT Sbjct: 789 SNSNSFRYSGGSRDDT 804 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,232,758 Number of Sequences: 37544 Number of extensions: 59289 Number of successful extensions: 149 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 14,793,348 effective HSP length: 31 effective length of database: 13,629,484 effective search space used: 258960196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -