BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N21 (443 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77270.1 68414.m08999 expressed protein 31 0.26 At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type f... 29 1.9 At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 29 1.9 At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly ... 27 4.3 At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit... 27 5.7 At3g48500.1 68416.m05294 expressed protein 27 5.7 At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) i... 27 5.7 At1g15200.1 68414.m01817 protein-protein interaction regulator f... 27 7.5 At1g65200.1 68414.m07392 ubiquitin carboxyl-terminal hydrolase-r... 26 10.0 >At1g77270.1 68414.m08999 expressed protein Length = 682 Score = 31.5 bits (68), Expect = 0.26 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +2 Query: 68 TRYISDRRCANIRRNSAAVVMRVRKKLKTGL-RIRRQDLPQPVPLVLREGQDAQRFENRE 244 TRY+ D + N R + + + R K+LKT + R + + P+V + +D QR +NRE Sbjct: 390 TRYVRDSQEKNTRNDESQTIFRASKRLKTEIGRADHNSISKTNPVV--KTKDIQR-KNRE 446 >At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 144 Score = 28.7 bits (61), Expect = 1.9 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 120 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 260 P+SC C R PVCG D TY C D +++VK+G C+ Sbjct: 68 PASCPVQCFRP-DPVCGEDSVTYWCGC-----ADALCHGVRVVKQGACD 110 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 153 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 260 PVCG+DG TY C D ++VK+G C+ Sbjct: 53 PVCGTDGVTYWCGC-----PDAACHGARVVKKGACD 83 >At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly identical to SP|P15455 [Plant Mol Biol 11:805-820 (1988)]; contains Pfam profile PF00190 Cupin and Prosite 11-S plant seed storage proteins signature PS00305 Length = 472 Score = 27.5 bits (58), Expect = 4.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 291 YAPVCGTDGNTYPNKCSLECSRPLAPSLEMKHRGECHEVKVAD 419 YA G G +PN+C L+ L PS +K E ++V D Sbjct: 21 YAAQQGQQGQQFPNECQLDQLNALEPSHVLK--SEAGRIEVWD 61 >At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At2) / UFO-binding protein (UIP2) E3 ubiquitin ligase; skp1b; identical to UIP2 GI:3719211 from [Arabidopsis thaliana]; contains Pfam profiles PF01466: Skp1 family, dimerisation domain and PF03931:Skp1 family, tetramerisation domain; identical to cDNA UFO binding protein UIP2 mRNA, partial cds GI:3719210 Length = 171 Score = 27.1 bits (57), Expect = 5.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 118 CRRHARAQET*DRSADQTARLTTTSAS 198 C+RH A E + +AD A TTT+ + Sbjct: 60 CKRHVEAAEKSETTADAAAATTTTTVA 86 >At3g48500.1 68416.m05294 expressed protein Length = 668 Score = 27.1 bits (57), Expect = 5.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 285 FIYAPVCGTDGNTYPNKCSLECSRPLAP 368 F + P+ DG+T P++ +C RP P Sbjct: 354 FDFPPIFHRDGDTNPDEIRRDCGRPPEP 381 >At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) identical to GDP-mannose pyrophosphorylase from Arabidopsis thaliana [GI:3598958]; updated per Conklin PL et al, PNAS 1999, 96(7):4198-203 Length = 361 Score = 27.1 bits (57), Expect = 5.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 442 RVQIHGCISATLTSWHS 392 R++ H CIS+++ WHS Sbjct: 297 RIKKHACISSSIIGWHS 313 >At1g15200.1 68414.m01817 protein-protein interaction regulator family protein contains Pfam PF04696: pinin/SDK/memA/ protein conserved region Length = 423 Score = 26.6 bits (56), Expect = 7.5 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +2 Query: 80 SDRRCANIRRNSAAVVMRVRKKLKTGLRIRRQDLPQPVPLVLREGQDAQRFENRER 247 SD++ + + R S + R ++ +T R LP+P P VL + +D + NR R Sbjct: 112 SDKKQSGLHRGSWS--QRDAEQRRTNKRYEAFALPEPAPRVLPKNED-PKLVNRNR 164 >At1g65200.1 68414.m07392 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1101 Score = 26.2 bits (55), Expect = 10.0 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 189 QCLLYCERDKTHSDLKIVKEGTCEEAD--PCVCTFIYAPVCGT 311 Q + +CE D+ + L+ +K+ CE D VC + + C T Sbjct: 383 QIICFCECDELNQILEFLKKIKCERDDGTDLVCRVVESFYCAT 425 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,513,309 Number of Sequences: 28952 Number of extensions: 195780 Number of successful extensions: 581 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 712739520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -