BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N18 (519 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54670.1 68418.m06807 kinesin-like protein C (KATC) 30 0.81 At5g28930.1 68418.m03578 hypothetical protein various predicted ... 29 1.4 At4g04700.1 68417.m00690 calcium-dependent protein kinase, putat... 29 2.5 At3g26230.1 68416.m03272 cytochrome P450 family protein contains... 29 2.5 At5g26860.1 68418.m03204 Lon protease homolog 2, mitochondrial a... 28 3.3 At4g33230.1 68417.m04730 pectinesterase family protein contains ... 27 7.6 At4g05470.1 68417.m00829 F-box family protein (FBL21) contains s... 27 7.6 At2g40910.2 68415.m05048 F-box protein-related similar to F-box... 27 7.6 At2g40910.1 68415.m05049 F-box protein-related similar to F-box... 27 7.6 At1g15520.1 68414.m01867 ABC transporter family protein similar ... 27 7.6 >At5g54670.1 68418.m06807 kinesin-like protein C (KATC) Length = 754 Score = 30.3 bits (65), Expect = 0.81 Identities = 22/63 (34%), Positives = 36/63 (57%) Frame = +1 Query: 163 MQLYNSVIVSDYKAAVKTTFQLEKECRSDVISSVVNKLLLEGQPNVVEYAYSLWYRSGED 342 +QLYNS + D A +T + EKE R+ +I ++ N L+GQ + ++ + S ED Sbjct: 208 LQLYNSKLQGDLDEAHETIKRGEKE-RTAIIENIGN---LKGQFSALQEQLAASKASQED 263 Query: 343 IVK 351 I+K Sbjct: 264 IMK 266 >At5g28930.1 68418.m03578 hypothetical protein various predicted proteins, Arabidopsis thaliana Length = 509 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 154 DPVMQLYNSVIVSDYKAAVKTTFQLEKECRSDV 252 D V+ YNSV V D ++ T F EKE + DV Sbjct: 286 DDVVSFYNSVDVPDGQSCGGTNFNNEKEFQGDV 318 >At4g04700.1 68417.m00690 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069 Length = 485 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 199 KAAVKTTFQLEKECRSDVISSVVNKLLLEGQPNVVEYAYSLWYRSGEDIVKVY 357 K +KT + ++EC DV + L G+PN+VE+ + + IV Y Sbjct: 57 KTILKTKLK-DEECEEDVKREIRIMKQLSGEPNIVEFKNAYEDKDSVHIVMEY 108 >At3g26230.1 68416.m03272 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 498 Score = 28.7 bits (61), Expect = 2.5 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 4/89 (4%) Frame = +1 Query: 181 VIVSDYKAAVKTTFQLEKECRSDVISSVVNKLLLEGQP-NVVEYAYSLWYRSGEDIVKVY 357 V++S +AA + + EC + I++V +KL +GQ + Y SL +K + Sbjct: 71 VVISSTEAAEEALKVHDLECCTRPITNVTSKLWRDGQDIGLAPYGESLRELRKLSFLKFF 130 Query: 358 FPIE---FRLLFNEDPVLITNKRDELALK 435 + FR + E+ L+ K E ALK Sbjct: 131 STTKVRSFRYIREEENDLMVKKLKEAALK 159 >At5g26860.1 68418.m03204 Lon protease homolog 2, mitochondrial almost identical to Lon protease homolog 2 mitochondrial precursor SP:P93655, GI:1848290 from [Arabidopsis thaliana] Length = 940 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -1 Query: 384 KQQSKLYRKVNFDYVLTGSVPETVSVFDD 298 KQ K+YRK+ V G+VPE +V D Sbjct: 655 KQIEKIYRKIALKLVREGAVPEEPAVASD 683 >At4g33230.1 68417.m04730 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 609 Score = 27.1 bits (57), Expect = 7.6 Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +1 Query: 55 VLSALVTRVSLTPLCNNTAVSITSNDSPPFNNADPVMQLYNSVIV--SDYKAAVKTTFQL 228 ++ L P C NT + T D+P DP L ++++ D K L Sbjct: 94 IIQTLCNSTLYKPTCQNTLKNETKKDTP---QTDPRSLLKSAIVAVNDDLDQVFKRVLSL 150 Query: 229 EKECRSDVISSVVNKLLLE 285 + E + D + KLL++ Sbjct: 151 KTENKDDKDAIAQCKLLVD 169 >At4g05470.1 68417.m00829 F-box family protein (FBL21) contains similarity to N7 protein GI:3273101 from [Medicago truncatula] Length = 576 Score = 27.1 bits (57), Expect = 7.6 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -2 Query: 173 YNCITGSALLNGGESLEVIETAVLLHRGV 87 Y +T ++NG E L ++ET V+ H + Sbjct: 143 YEPMTNKGVMNGIEKLPLLETLVIFHSSI 171 >At2g40910.2 68415.m05048 F-box protein-related similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; similar to F-box protein family, AtFBX8 (GI:20197464) [Arabidopsis thaliana] Length = 442 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -1 Query: 435 LESKFITFIGN*HWIFVKQQSKLYRKVNFDYVLTGSVPETVSVF 304 + S F T + + HW+FV + +RKV P TV F Sbjct: 222 ISSAFFTNLKSEHWVFVLEAGGSWRKVRTLESYHPHAPSTVGQF 265 >At2g40910.1 68415.m05049 F-box protein-related similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; similar to F-box protein family, AtFBX8 (GI:20197464) [Arabidopsis thaliana] Length = 449 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -1 Query: 435 LESKFITFIGN*HWIFVKQQSKLYRKVNFDYVLTGSVPETVSVF 304 + S F T + + HW+FV + +RKV P TV F Sbjct: 229 ISSAFFTNLKSEHWVFVLEAGGSWRKVRTLESYHPHAPSTVGQF 272 >At1g15520.1 68414.m01867 ABC transporter family protein similar to ABC1 protein GI:14331118 from [Nicotiana plumbaginifolia] Length = 1423 Score = 27.1 bits (57), Expect = 7.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 324 PETVSVFDDVWLSFEE*FIYDGADD 250 PET ++FDD+ L E IY+G D Sbjct: 388 PETFNLFDDIILIAEGEIIYEGPRD 412 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.134 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,621,066 Number of Sequences: 28952 Number of extensions: 171434 Number of successful extensions: 426 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -