BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N12 (469 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.18 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 0.71 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 0.94 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 0.94 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 0.94 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 0.94 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 0.94 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 0.94 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 0.94 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 1.2 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 1.2 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 1.2 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 1.2 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 22 3.8 AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 22 3.8 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 22 3.8 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 22 3.8 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 6.6 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 6.6 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 8.7 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 8.7 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 8.7 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 26.2 bits (55), Expect = 0.18 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -3 Query: 257 PPGLPSKPRSPLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIP 102 P G+P + F + G+P P++PF+ NP P P SP +P +P Sbjct: 1135 PGGIPGPNGIKMPSF---MEGMPHLPFTPFNFWNPPPFMP-SPFMAGAPNVP 1182 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.71 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 124 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPQFIPPN 166 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.94 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 124 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPRFIPPN 166 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.94 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 124 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPRFIPPN 166 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.94 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 124 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPRFIPPN 166 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.94 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 124 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPRFIPPN 166 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.94 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 124 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPRFIPPN 166 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 0.94 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 124 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPRFIPPN 166 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.8 bits (49), Expect = 0.94 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -3 Query: 227 PLSPFWPMIPGIPCGPWSPFSPGNP*PTGPWSPLSPFSPVIPGN 96 P+ + P P GPW P P P +PF IP N Sbjct: 127 PVPIYCGNFPSRPMGPWVPMQEQIP-RFRHIGPSTPFPRFIPPN 169 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 461 NPGAPGAPSDPG 426 NPG PG P D G Sbjct: 331 NPGPPGVPGDHG 342 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 391 PGPRGVPGIDG 423 PGP GVPG G Sbjct: 332 PGPPGVPGDHG 342 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 461 NPGAPGAPSDPG 426 NPG PG P D G Sbjct: 331 NPGPPGVPGDHG 342 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 391 PGPRGVPGIDG 423 PGP GVPG G Sbjct: 332 PGPPGVPGDHG 342 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 23.4 bits (48), Expect = 1.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +1 Query: 28 KGELGREGIAGQPGNDGAQGPTGFPGITGEKGDKGDQGPVGYG 156 +G+ G G G G +G TGF + D D YG Sbjct: 80 RGKGRGHGKGGSRGRGGNRGRTGFNNKNKDGDDNNDYEDNDYG 122 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 23.4 bits (48), Expect = 1.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 461 NPGAPGAPSDPG 426 NPG PG P D G Sbjct: 270 NPGPPGVPGDHG 281 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 391 PGPRGVPGIDG 423 PGP GVPG G Sbjct: 271 PGPPGVPGDHG 281 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +1 Query: 64 PGNDGAQGPTGFPGITGEKGDKGDQ----GPVGY-GLPGE 168 P + + P GF G+ G+K D+ P+G+ G+ G+ Sbjct: 81 PEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGK 120 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +1 Query: 64 PGNDGAQGPTGFPGITGEKGDKGDQ----GPVGY-GLPGE 168 P + + P GF G+ G+K D+ P+G+ G+ G+ Sbjct: 82 PEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGK 121 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +1 Query: 64 PGNDGAQGPTGFPGITGEKGDKGDQ----GPVGY-GLPGE 168 P + + P GF G+ G+K D+ P+G+ G+ G+ Sbjct: 81 PEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGK 120 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +1 Query: 64 PGNDGAQGPTGFPGITGEKGDKGDQ----GPVGY-GLPGE 168 P + + P GF G+ G+K D+ P+G+ G+ G+ Sbjct: 81 PEDINKRAPMGFQGMRGKKASFDDEYYKRAPMGFQGMRGK 120 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 250 PGGQGAIGMSGEKGDRGFPGRS 315 P G SGE RG G+S Sbjct: 380 PSGSSVHSDSGENNSRGHSGQS 401 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -3 Query: 422 PSIPGTPRGPG 390 P P PRGPG Sbjct: 393 PCTPSPPRGPG 403 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 181 PGHPFLLVIHSPLVPGHLC 125 PG ++V H LV G LC Sbjct: 84 PGDTKVMVEHGELVMGILC 102 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 176 SPFSPGNP*PTGPWSP 129 S +PGN P+GP SP Sbjct: 56 SLINPGNFSPSGPNSP 71 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 176 SPFSPGNP*PTGPWSP 129 S +PGN P+GP SP Sbjct: 56 SLINPGNFSPSGPNSP 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.308 0.146 0.454 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,214 Number of Sequences: 438 Number of extensions: 3164 Number of successful extensions: 25 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.0 bits)
- SilkBase 1999-2023 -