BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N11 (388 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20880.1 68417.m03028 ethylene-responsive nuclear protein / e... 31 0.20 At1g55110.1 68414.m06294 zinc finger (C2H2 type) family protein ... 31 0.27 At4g39960.1 68417.m05660 DNAJ heat shock family protein similar ... 30 0.47 At2g22360.1 68415.m02653 DNAJ heat shock family protein similar ... 29 0.82 At5g56820.1 68418.m07090 F-box family protein contains F-box dom... 29 1.1 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 29 1.1 At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding protei... 29 1.1 At1g62305.2 68414.m07030 expressed protein contains Pfam profile... 29 1.4 At1g62305.1 68414.m07029 expressed protein contains Pfam profile... 29 1.4 At1g21810.1 68414.m02729 expressed protein 28 1.9 At4g17440.1 68417.m02610 expressed protein 27 4.4 At3g02930.1 68416.m00288 expressed protein ; expression support... 27 4.4 At2g28710.1 68415.m03490 zinc finger (C2H2 type) family protein ... 27 4.4 At2g20720.1 68415.m02433 pentatricopeptide (PPR) repeat-containi... 27 5.8 At1g48210.1 68414.m05382 serine/threonine protein kinase, putati... 27 5.8 At1g17070.1 68414.m02077 D111/G-patch domain-containing protein ... 27 5.8 At3g46710.1 68416.m05071 disease resistance protein (CC-NBS-LRR ... 26 7.6 At3g46420.1 68416.m05032 leucine-rich repeat family protein / pr... 26 7.6 At1g50730.1 68414.m05705 expressed protein 26 7.6 >At4g20880.1 68417.m03028 ethylene-responsive nuclear protein / ethylene-regulated nuclear protein (ERT2) identical to ethylene-regulated nuclear protein [Arabidopsis thaliana] gi|2765442|emb|CAA75349 Length = 405 Score = 31.5 bits (68), Expect = 0.20 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 67 QKEVDRLEDDLVAEREKSKLLQEEMEATLHDIQN 168 Q +D L D L+ +R K KL +EE + HD +N Sbjct: 184 QIRIDSLIDKLIGKRHKEKLEEEEESTSTHDRRN 217 >At1g55110.1 68414.m06294 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 455 Score = 31.1 bits (67), Expect = 0.27 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 126 PAGGNGGHAPRHSEHVNTPSPSLPYPCPARSFVSL 230 P G NG P + VNT S P+P PA S +L Sbjct: 293 PNGNNGNLFPPVASSVNTGRSSFPHPSPAMSATAL 327 >At4g39960.1 68417.m05660 DNAJ heat shock family protein similar to SP|Q9S5A3 Chaperone protein dnaJ {Listeria monocytogenes}; contains Pfam profiles PF00226 DnaJ domain, PF01556 DnaJ C terminal region, PF00684 DnaJ central domain (4 repeats) Length = 447 Score = 30.3 bits (65), Expect = 0.47 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 178 VFTCSECRGAWPPFPPAGVCS--FRARRPGRLQACRPPFGVSVRSAQQIQHE 29 V TCS C G P G CS R RR R+ + + P GV S +++ E Sbjct: 270 VMTCSPCNGTGEISKPCGACSGDGRVRRTKRI-SLKVPAGVDSGSRLRVRGE 320 >At2g22360.1 68415.m02653 DNAJ heat shock family protein similar to SP|Q9S5A3 Chaperone protein dnaJ {Listeria monocytogenes}; contains Pfam profiles PF00226 DnaJ domain, PF01556 DnaJ C terminal region, PF00684 DnaJ central domain (4 repeats) Length = 442 Score = 29.5 bits (63), Expect = 0.82 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 178 VFTCSECRGAWPPFPPAGVCS--FRARRPGRLQACRPPFGVSVRSAQQIQHE 29 V TCS C G P G CS R R+ R+ + + P GV S +++ E Sbjct: 264 VMTCSSCNGTGEISTPCGTCSGDGRVRKTKRI-SLKVPAGVDSGSRLRVRGE 314 >At5g56820.1 68418.m07090 F-box family protein contains F-box domain Pfam:PF00646 Length = 435 Score = 29.1 bits (62), Expect = 1.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 92 TTWSPSAKRANSCRRKWRPRSTTF 163 T W PS +R + C +R RSTTF Sbjct: 205 TIWVPSLQRLSICDESYRFRSTTF 228 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 55 VQKLQKEVDRLEDDLVA---EREKSKLLQEEMEATLHDIQN 168 VQ+L +E +L DL + E EKSK E + + LH++ + Sbjct: 438 VQRLSEEKSKLLSDLESSKEEEEKSKKAMESLASALHEVSS 478 >At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding protein-related similar to matrix-localized MAR DNA binding protein MFP1 GI:1771158 from [Lycopersicon esculentum] Length = 726 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 52 SVQKLQKEVDRLEDDLVAEREKSKLLQEEMEATLHDIQNM 171 +V L KEV +E ++ ERE K L+ ++E + + M Sbjct: 565 TVLSLNKEVKGMEKQILMEREARKSLETDLEEAVKSLDEM 604 >At1g62305.2 68414.m07030 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 354 Score = 28.7 bits (61), Expect = 1.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 62 NSKRRSTGLKTTWSPSAKRANSCRRKWRPRSTTFRTC 172 N R T TTW+ SAK+A + + W P + T C Sbjct: 256 NEMERRTVTYTTWNLSAKKAEA--KSWHPLTFTSDNC 290 >At1g62305.1 68414.m07029 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 378 Score = 28.7 bits (61), Expect = 1.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 62 NSKRRSTGLKTTWSPSAKRANSCRRKWRPRSTTFRTC 172 N R T TTW+ SAK+A + + W P + T C Sbjct: 280 NEMERRTVTYTTWNLSAKKAEA--KSWHPLTFTSDNC 314 >At1g21810.1 68414.m02729 expressed protein Length = 628 Score = 28.3 bits (60), Expect = 1.9 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 55 VQKLQKEVDRLEDDLVAEREKSKLLQEEMEATLHD 159 ++KLQ E D L+ +++ +E K E+EA + D Sbjct: 353 LEKLQAEKDELDSEVICCKEAEKRFSLELEAVVGD 387 >At4g17440.1 68417.m02610 expressed protein Length = 215 Score = 27.1 bits (57), Expect = 4.4 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -1 Query: 268 ERYHSDRNRTRRASETNERAGQG*GSEGEGVFTCSECRG 152 ER ++ +R R G +G GVFT C G Sbjct: 70 EREETEEEEAKRTWNLRPRKAYGGSKKGNGVFTAEVCGG 108 >At3g02930.1 68416.m00288 expressed protein ; expression supported by MPSS Length = 806 Score = 27.1 bits (57), Expect = 4.4 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +1 Query: 52 SVQKLQKEVDRLEDDLVA---EREKSKLLQEEMEATLHDIQN 168 SVQ+L +E ++ +L + E EKSK E + + LH++ + Sbjct: 426 SVQRLLEEKKKILSELESSKEEEEKSKKAMESLASALHEVSS 467 >At2g28710.1 68415.m03490 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 156 Score = 27.1 bits (57), Expect = 4.4 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -1 Query: 178 VFTCSECRGAWPPFPPAGVCSFRARRPGRLQACRPPFGVSVRSAQQIQHE 29 VF C C +P F G RR L+ PP S + + ++HE Sbjct: 33 VFACKTCNKEFPSFQALGGHRASHRRSAALEGHAPP---SPKRVKPVKHE 79 >At2g20720.1 68415.m02433 pentatricopeptide (PPR) repeat-containing protein contains Pfam TIGR00756: pentatricopeptide repeat domain Length = 299 Score = 26.6 bits (56), Expect = 5.8 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 58 QKLQKEVDRL-EDDLVAEREKSKLLQEEMEATLHDIQN 168 + L +V+ L ED+ E E+ K + E ME LHD N Sbjct: 197 ESLAHKVNTLVEDEDAKEEERRKRVAEAMEGRLHDRWN 234 >At1g48210.1 68414.m05382 serine/threonine protein kinase, putative similar to Pto kinase interactor 1 [Lycopersicon esculentum] gi|3668069|gb|AAC61805; contains protein kinase domain, Pfam:PF00069 Length = 363 Score = 26.6 bits (56), Expect = 5.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 126 PAGGNGGHAPRHSEHVNTP-SPSLPYPCPA 212 PAG NGGH R +N P P P PA Sbjct: 26 PAGYNGGHYQRADPPMNQPVIPMQPISVPA 55 >At1g17070.1 68414.m02077 D111/G-patch domain-containing protein Similar to SP|Q9ERA6 Tuftelin-interacting protein 11 {Mus musculus}; contains Pfam profile PF01585: G-patch domain Length = 849 Score = 26.6 bits (56), Expect = 5.8 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 55 VQKLQKEVDRLEDDLVAEREKSKLLQEEMEATLHD 159 V ++ E+ +++ DL ERE + LQ+E E +++ Sbjct: 354 VDLVEHEIQKIDRDLRNERESALSLQQEKEMLINE 388 >At3g46710.1 68416.m05071 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 847 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 64 LQKEVDRLEDDLVAEREKSKLLQEEMEATLHDI 162 L + + LE+ +E E K+ Q+E+E LHDI Sbjct: 232 LMRIISSLEE--TSEGELEKMAQQELEVYLHDI 262 >At3g46420.1 68416.m05032 leucine-rich repeat family protein / protein kinase family protein contains leucine rich repeat (LRR) domains, INTERPRO:IPR001611; contains serine/threonine protein kinases active-site signature, Prosite:PS00108 Length = 838 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 244 YCDRNDIVRTVRRYDSSGSV-YHLVGRTSDNVISF 345 YCD + + V Y S+G + +HL GR + V+S+ Sbjct: 593 YCDDRNHLALVYEYMSNGDLKHHLSGRNNGFVLSW 627 >At1g50730.1 68414.m05705 expressed protein Length = 1013 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 61 KLQKEVDRLEDDLVAEREKSKLLQEEMEATLHDI 162 K++ +D L DD+V+ + K L EE +A+L I Sbjct: 509 KMENHLDALLDDIVS-LARDKFLSEEEQASLQSI 541 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,701,643 Number of Sequences: 28952 Number of extensions: 127454 Number of successful extensions: 542 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 547638520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -