BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N08 (480 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69717-1|CAA93531.1| 1391|Caenorhabditis elegans Hypothetical pr... 29 1.3 Z81030-1|CAB02703.1| 1204|Caenorhabditis elegans Hypothetical pr... 27 7.0 Z80215-13|CAI79137.1| 640|Caenorhabditis elegans Hypothetical p... 27 9.3 >Z69717-1|CAA93531.1| 1391|Caenorhabditis elegans Hypothetical protein E01G6.1 protein. Length = 1391 Score = 29.5 bits (63), Expect = 1.3 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 3/93 (3%) Frame = +1 Query: 157 CEPLLNLFRNKSRTAEDKKLLGDSQC--GYENNIPMVCCPIS-NACKTPDDKPGICVGLY 327 C+ L+ L K+ +E ++ + C GYE N CCP S NAC + C G Sbjct: 424 CDGLVPL---KNPNSELQRCSEEDPCPAGYECNDSSYCCPSSENACNANMSRGNGCKG-- 478 Query: 328 NCEHITYMMLDKTRKSTMDYVRQSVCNGPETFS 426 + DK++K +V P F+ Sbjct: 479 -STQRSMWFYDKSKKKCSQFVYNGCGGTPNRFT 510 >Z81030-1|CAB02703.1| 1204|Caenorhabditis elegans Hypothetical protein C01G10.1 protein. Length = 1204 Score = 27.1 bits (57), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 131 DSFLGVVQVCARIKFTDINRIYETVEKIIILL 36 D F ++ V ++ T++NR+ E EK+ +LL Sbjct: 59 DQFNNIIDVDIKVARTELNRMGEEFEKLSLLL 90 >Z80215-13|CAI79137.1| 640|Caenorhabditis elegans Hypothetical protein C36B1.12b protein. Length = 640 Score = 26.6 bits (56), Expect = 9.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 244 NNIPMVCCPISNACKTPDD 300 N +P+ C P+ N+ +PDD Sbjct: 596 NGVPVECSPLINSSSSPDD 614 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,001,882 Number of Sequences: 27780 Number of extensions: 231767 Number of successful extensions: 546 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 882200194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -