BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N07 (473 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0333 - 12541946-12542029,12544231-12544278,12545053-125451... 28 3.3 03_05_0517 - 25118232-25118730,25119002-25119273 28 3.3 03_02_0269 + 7001891-7002212,7003598-7004037 28 3.3 12_02_0219 + 15822050-15824896 27 5.8 11_04_0321 - 16359390-16359539,16359674-16359746,16360448-163608... 27 5.8 01_05_0608 - 23628100-23631486 27 5.8 07_03_1693 - 28756331-28756435,28756558-28756664,28757114-287572... 27 7.7 >05_03_0333 - 12541946-12542029,12544231-12544278,12545053-12545158, 12546943-12547046,12547127-12547264,12547395-12547799 Length = 294 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = -2 Query: 181 DRLMVERRKDPGSQ*QRVHYCRPMNTTIVHHVNSVCGSHGQYGEEEKHESFHCRIV 14 D L+ +K + RVH C + ++ ++N V H +++K E+ HC +V Sbjct: 82 DGLLDACKKSVVKEHNRVHLCFKSSKSLKCNLNQVPVLHYLCLDDQKFETSHCHVV 137 >03_05_0517 - 25118232-25118730,25119002-25119273 Length = 256 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +1 Query: 151 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 261 D FF++ P GN T P VD P P + + Sbjct: 37 DWFFTRKGESPQGNISKEETAPTGVDVTDPGRPGRAF 73 >03_02_0269 + 7001891-7002212,7003598-7004037 Length = 253 Score = 28.3 bits (60), Expect = 3.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 286 SHHGREGCRIAWVDNWDD*NRR 221 + H R+ R+AW D W D +R+ Sbjct: 62 TEHARQRMRVAWADGWVDGSRK 83 >12_02_0219 + 15822050-15824896 Length = 948 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 3 DNSDTIRQ*KLSC-FSSSPYWPWLPXTEFTWWTIVV 107 D D +R+ ++ C F+ P WPWL ++ T+V+ Sbjct: 269 DFGDPLRKHEMHCRFTQGPPWPWLAVAS-SYGTLVI 303 >11_04_0321 - 16359390-16359539,16359674-16359746,16360448-16360845, 16360919-16362673,16362751-16362861,16363745-16363962, 16364088-16364196 Length = 937 Score = 27.5 bits (58), Expect = 5.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 244 YPPKRYDNPLARGGK 288 YPPKRY NP+ G+ Sbjct: 859 YPPKRYSNPVGPAGR 873 >01_05_0608 - 23628100-23631486 Length = 1128 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 367 FSNAFYINISFFGFGGNYQGSIKIFFSVTY 456 F N Y+N+S+ GFGG I S+ Y Sbjct: 145 FKNLRYLNLSWAGFGGKIPSQIGNISSLQY 174 >07_03_1693 - 28756331-28756435,28756558-28756664,28757114-28757245, 28757412-28757478,28757553-28757635,28757824-28757905, 28763101-28763177,28763278-28763361,28763443-28763512, 28763625-28763713,28763801-28764487,28765700-28765997 Length = 626 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/76 (21%), Positives = 33/76 (43%) Frame = -2 Query: 253 WVDNWDD*NRRTPVQCLWVHNFR*DRLMVERRKDPGSQ*QRVHYCRPMNTTIVHHVNSVC 74 W ++ D+ + +Q +V NFR ++E+R + + P + S C Sbjct: 192 WTNSNDECGAKCDMQMNFVRNFRGTAQVLEKRGYTQFTPHYITWYCPEAFVLSKQCRSQC 251 Query: 73 GSHGQYGEEEKHESFH 26 +HG+Y + + F+ Sbjct: 252 INHGRYCAPDPEQDFN 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,080,366 Number of Sequences: 37544 Number of extensions: 227745 Number of successful extensions: 538 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -