BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0002_N07
(473 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC020499-1|AAH20499.1| 327|Homo sapiens GBL protein protein. 29 8.2
>BC020499-1|AAH20499.1| 327|Homo sapiens GBL protein protein.
Length = 327
Score = 29.1 bits (62), Expect = 8.2
Identities = 15/55 (27%), Positives = 25/55 (45%)
Frame = +1
Query: 7 TLTLFDNESFRVFLLRRIGHGCRXQSSRGGQ*WCSSDGNSEHVVIANPDPFFSQP 171
T ++ +F + I G +SSRG C+ G+S+++V P P P
Sbjct: 243 TCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTGEPRPGLPHP 297
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,189,700
Number of Sequences: 237096
Number of extensions: 1251273
Number of successful extensions: 2586
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2507
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2586
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 4156838854
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -