BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N07 (473 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.53 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 28 2.8 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 27 4.9 At3g54830.1 68416.m06074 amino acid transporter family protein b... 27 4.9 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 27 4.9 At5g19690.1 68418.m02342 oligosaccharyl transferase STT3 subunit... 27 6.5 At5g45520.1 68418.m05591 hypothetical protein 27 8.6 At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorop... 27 8.6 At1g09280.2 68414.m01038 expressed protein contains Pfam profile... 27 8.6 At1g09280.1 68414.m01037 expressed protein contains Pfam profile... 27 8.6 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.7 bits (66), Expect = 0.53 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 136 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPLARGG 285 ++A P P+ P+ GP P+S+ PA N+P Y P GG Sbjct: 245 MMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGG 294 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.3 bits (60), Expect = 2.8 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 148 PDPFFSQPSNGPSG--NYEPISTGPAFVDFNHPNYPPKRYDNPLAR 279 P P S P N P ++ P + P+ +N P PP YD P R Sbjct: 357 PYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGR 402 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 169 PSNGPSGNYEPISTGPAFVDFNHP-NYPPKRYDNP 270 PS+ PS ++ P TGP+ + HP ++ P D P Sbjct: 236 PSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPP 270 >At3g54830.1 68416.m06074 amino acid transporter family protein belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 546 Score = 27.5 bits (58), Expect = 4.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 356 PIFNLVMPFISIFLFLVLVVITKVQLKFS-FL*HIKQK 466 P F LVM I FL +++ + T S FL H+K+K Sbjct: 477 PFFGLVMSLIGSFLTMLIFLDTDADTTASLFLEHLKEK 514 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 27.5 bits (58), Expect = 4.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 SDTIRQ*KLSCFSSSPYWPWLP 74 S I + + SC SSP+ PW+P Sbjct: 96 SKIIEEKRYSCIISSPFTPWVP 117 >At5g19690.1 68418.m02342 oligosaccharyl transferase STT3 subunit family protein similar to SP|P39007 Oligosaccharyl transferase STT3 subunit {Saccharomyces cerevisiae}; contains Pfam profile PF02516: Oligosaccharyl transferase STT3 subunit Length = 779 Score = 27.1 bits (57), Expect = 6.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 364 KNWENIIRLIIISPSFKIAYLYETFTSHH 278 K ++ + R I FK+ + E FTSHH Sbjct: 710 KGYDRVRRTEIGKKHFKLTHFEEVFTSHH 738 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 26.6 bits (56), Expect = 8.6 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -2 Query: 367 IKNWENIIRLIII--SPSFKIAYLYETFTSHHGREGCRIAW 251 +K+ N+ +L I SFK+ L E+ T G E +IAW Sbjct: 507 VKHLVNLRKLSITVNKYSFKVESLMESLTGLQGLESLKIAW 547 >At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorophyll b synthase identical to chlorophyll a oxygenase GI:5853117 from [Arabidopsis thaliana]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 511 Score = 26.6 bits (56), Expect = 8.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 330 FLLVLKSLIFMRHLLPTTGERVVVSLGWIIGMIEIDERRSSAYGFIIS 187 F +LK+L FM HL E+V V WI + + +Y F IS Sbjct: 462 FAPILKNLPFMEHLWRHFAEQVKVHHKWIDHLQPSSQSCFLSYRFYIS 509 >At1g09280.2 68414.m01038 expressed protein contains Pfam profile: PF03959 domain of unknown function (DUF341) Length = 575 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -2 Query: 364 KNWENIIRLIIISPSFKIAYLYETFTSHHGREGCRIAWVDNWD 236 K +NI L+ I ++ ++Y+T T G + AW+ + D Sbjct: 372 KKLKNIAELVFIDAPHELQFIYQTATPPSGVCNKKFAWLVSSD 414 >At1g09280.1 68414.m01037 expressed protein contains Pfam profile: PF03959 domain of unknown function (DUF341) Length = 581 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -2 Query: 364 KNWENIIRLIIISPSFKIAYLYETFTSHHGREGCRIAWVDNWD 236 K +NI L+ I ++ ++Y+T T G + AW+ + D Sbjct: 378 KKLKNIAELVFIDAPHELQFIYQTATPPSGVCNKKFAWLVSSD 420 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,015,059 Number of Sequences: 28952 Number of extensions: 183738 Number of successful extensions: 499 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -