BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N05 (475 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 5.1 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 5.1 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 8.9 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 8.9 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 8.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 8.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.9 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 5.1 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 231 PAPALQRLLTASTTGPPPQDLVKNIYSNQRVYID 332 P P L R + T P Q + + S+ VY D Sbjct: 828 PTPNLLRYFASIATNPKEQAQLNLLASDPAVYED 861 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 5.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 382 LHHCFETADR 353 LH CF+T DR Sbjct: 50 LHSCFQTMDR 59 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 264 STTGPPP 284 STTGPPP Sbjct: 380 STTGPPP 386 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 20.6 bits (41), Expect = 8.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 340 AFWSI*TR*FEYMFFTRSCGGGPVVD 263 A SI + EY+FF + G P+ D Sbjct: 390 AIRSIGLKCLEYLFFFKMIGDVPIDD 415 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 20.6 bits (41), Expect = 8.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 340 AFWSI*TR*FEYMFFTRSCGGGPVVD 263 A SI + EY+FF + G P+ D Sbjct: 390 AIRSIGLKCLEYLFFFKMIGDVPIDD 415 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -2 Query: 423 RFCTFSHKGSLVLRFITVLRP 361 R+C F H +L +F ++ P Sbjct: 603 RYCLFGHNVTLANKFESLSEP 623 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 8.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -1 Query: 289 SCGGGPVV 266 SCGGGP + Sbjct: 369 SCGGGPTI 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,679 Number of Sequences: 438 Number of extensions: 2923 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12805416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -