BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N04 (535 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 38 7e-05 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 30 0.011 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.7 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.0 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 9.0 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 37.5 bits (83), Expect = 7e-05 Identities = 28/131 (21%), Positives = 58/131 (44%), Gaps = 1/131 (0%) Frame = +2 Query: 74 RLRQSLQKGKF-ESYGKKIDFHDEQAINFVGNYWQENADXV*REKLQQDYSTNLMKLSLA 250 R+ ++ +G + G+ I + + I+ +GN + + R Y +L + Sbjct: 314 RIYAAIHQGSVTDERGRSITLTENEGIDILGNMIESSILSPNRT-----YYGDLHNMGHV 368 Query: 251 MCSVQHPKPFDKHTFMPSALDFYQTALRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHF 430 S H P +H + TA+RDP FY+ + I +K L Y + +L++ Sbjct: 369 FISYIHD-PDHRHLESFGVMGDSATAMRDPIFYRWHSYIDDIFQEYKATLPRYTENQLNY 427 Query: 431 VGVKINDVVVE 463 G+ ++++ V+ Sbjct: 428 PGITVSNIEVQ 438 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 30.3 bits (65), Expect = 0.011 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 329 LRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVE 463 LRDP F++ + I FK L Y +L++ GV + ++ V+ Sbjct: 394 LRDPLFFRWHAYIDDMFQEFKATLPRYTVAQLNYPGVTVTNIEVQ 438 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.0 bits (47), Expect = 1.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 18 DTTSTQRKNYKHTFWTF*KDFVSPYR 95 + +T+R+ H W + F SPY+ Sbjct: 365 EAATTEREGGYHDIWMSGESFKSPYK 390 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.0 bits (47), Expect = 1.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 18 DTTSTQRKNYKHTFWTF*KDFVSPYR 95 + +T+R+ H W + F SPY+ Sbjct: 365 EAATTEREGGYHDIWMSGESFKSPYK 390 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 383 AFKHYLKPYPQEKLHFVGVKI 445 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 383 AFKHYLKPYPQEKLHFVGVKI 445 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 383 AFKHYLKPYPQEKLHFVGVKI 445 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 383 AFKHYLKPYPQEKLHFVGVKI 445 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 530 LFWSRIHC*W 501 LFW++ HC W Sbjct: 2269 LFWNKDHCDW 2278 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 20.6 bits (41), Expect = 9.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 277 WFRVLHRAHGERQ 239 +FR+ HR HG Q Sbjct: 342 YFRMPHRCHGNLQ 354 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,913 Number of Sequences: 336 Number of extensions: 2616 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -