BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N01 (545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 1.7 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 2.3 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.3 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 9.3 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 9.3 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 23.0 bits (47), Expect = 1.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 181 GHYGFHVHEKGDISG 225 G YG H H+ G ++G Sbjct: 9 GFYGSHHHQSGSVAG 23 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 2.3 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = -3 Query: 501 PQA---TRPPALPVFLESGWSVRPKSSARSCRTTALPRIPCAPVNAEM 367 PQA RP GW V P S + P IP AP A + Sbjct: 48 PQAILQVRPSTSAAADVDGWQVTPLPSDGTTSPEPDPEIPVAPEPAPL 95 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 77 LSPIWSGRTSEAILR 121 L P+W G SEA+ R Sbjct: 220 LPPVWQGGESEALAR 234 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 20.6 bits (41), Expect = 9.3 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -3 Query: 510 PMTPQATRPPALPVFLESGWSVRPKSSARSCRTTALPRIPCAPVNA 373 P TP A + + G V KS++ + RTT + P A Sbjct: 416 PSTPSADGSKPVQTTPKPGQWVPEKSTSTTQRTTTVSTTEAPPAPA 461 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 20.6 bits (41), Expect = 9.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 169 GLPPGHYG 192 G+PP HYG Sbjct: 59 GIPPHHYG 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,135 Number of Sequences: 336 Number of extensions: 2989 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -