BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_N01 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismuta... 108 1e-25 AY745232-1|AAU93511.1| 75|Anopheles gambiae SOD3A protein. 53 7e-09 AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 46 6e-07 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 25 1.6 AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. 25 2.2 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 25 2.2 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 25 2.2 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 2.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 3.8 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 24 3.8 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 5.0 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 5.0 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 5.0 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 5.0 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 5.0 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 5.0 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 5.0 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 5.0 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 5.0 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 5.0 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 5.0 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 5.0 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 6.6 >AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismutase 2 protein. Length = 211 Score = 108 bits (260), Expect = 1e-25 Identities = 48/110 (43%), Positives = 73/110 (66%), Gaps = 2/110 (1%) Frame = +1 Query: 58 RSQPTRAIAHLVGEN-IRGNITFTRLPDGK-VHVEGSIVGLPPGHYGFHVHEKGDISGGC 231 + QP +AI +L G + + GN+T ++ + V ++ ++VGL PG +GFH+HEKGD++ GC Sbjct: 17 KDQPRKAIVYLQGTSGVSGNVTISQPSCTEPVFIDINVVGLTPGKHGFHIHEKGDLTDGC 76 Query: 232 GSTGSHFNPENKEHGHPSDENRHVGDLGNAEFDQNYSSKIDMIDPHLGIY 381 STG H+NP+ HG P+D+ RHVGDLGN D+N +K D + +Y Sbjct: 77 ASTGGHYNPDKVSHGAPNDQVRHVGDLGNIAADENGIAKTSYSDTVVSLY 126 Score = 78.6 bits (185), Expect = 1e-16 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 359 STRISAFTGAHGILGRAVVLHERADDFGRTDHPDSRKTGNAGGRVACGVIGIL 517 S + + GA ++GRA+V+H DD G+T+HPDS KTGNAGGRVACGVIGIL Sbjct: 119 SDTVVSLYGARSVIGRAIVIHAEVDDLGKTNHPDSLKTGNAGGRVACGVIGIL 171 >AY745232-1|AAU93511.1| 75|Anopheles gambiae SOD3A protein. Length = 75 Score = 52.8 bits (121), Expect = 7e-09 Identities = 23/47 (48%), Positives = 33/47 (70%) Frame = +2 Query: 374 AFTGAHGILGRAVVLHERADDFGRTDHPDSRKTGNAGGRVACGVIGI 514 A +GA ++GR++V+H DD G H S+ TG+AG R+ACGVIG+ Sbjct: 26 ALSGALNVVGRSLVVHADPDDLGVGGHELSKTTGDAGARLACGVIGL 72 Score = 27.1 bits (57), Expect = 0.40 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 298 HVGDLGNAEFDQNYSSKIDM 357 H GD+GN D+N +K+D+ Sbjct: 1 HAGDMGNIVADENGEAKVDL 20 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 46.4 bits (105), Expect = 6e-07 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +2 Query: 383 GAHGILGRAVVLHERADDFGRTDHPDSRKTGNAGGRVACGVIGI 514 G I+GR + + E DD GR H S+ TGN+G +AC +IG+ Sbjct: 45 GDRSIIGRTLSISEYEDDLGRGKHDYSKTTGNSGNCIACAIIGV 88 Score = 39.1 bits (87), Expect = 9e-05 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 250 FNPENKEHGHPSDENRHVGDLGN 318 +NP+ +HG P D N HVGDLGN Sbjct: 1 YNPDGNDHGAPDDANCHVGDLGN 23 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 25.0 bits (52), Expect = 1.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 263 FSGLK*EPVEPQPPDMSPF 207 F GL EP EPQ ++ PF Sbjct: 272 FKGLWSEPFEPQATELKPF 290 >AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. Length = 94 Score = 24.6 bits (51), Expect = 2.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 397 NPVCSGKCRDAGRSYQSC 344 NP CS +CR G SC Sbjct: 67 NPTCSAQCRGRGYRRGSC 84 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 24.6 bits (51), Expect = 2.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 329 SNSALPRSPTWRFSSLGWP 273 SN LP + +RF + GWP Sbjct: 568 SNINLPETEQFRFCNCGWP 586 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 202 HEKGDISGGCGSTGSHFNPENKEHGHPSDENRH 300 H +S G GST + + + H HP + H Sbjct: 476 HSPHHVSPGMGSTVNGASLTHSHHAHPHHHHHH 508 Score = 23.4 bits (48), Expect = 5.0 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 181 GHYGFHVHEKGDISGGCGSTGSHFNPENKEHGHPSDEN 294 G Y + + G SGG S SH +P + G S N Sbjct: 453 GDYMNNCLQSGYFSGGFSSLHSHHSPHHVSPGMGSTVN 490 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 24.6 bits (51), Expect = 2.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 172 LPPGHYGFHVHEKGDISGGCGSTGSHFNPENKEHGHPSDENRHVG 306 L P + H+H+ +S G GS G H + GH + + H+G Sbjct: 324 LEPSLHLSHLHQMSAMSMGMGSMGLH----HHHPGHHAALHAHLG 364 Score = 23.4 bits (48), Expect = 5.0 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 169 GLPPGHYGFHVHEKGDISGGCGSTGSHF--NPENKEHGHPSDENRHVGDLG 315 G PG G G SGG GS H NP H H + G G Sbjct: 88 GPSPGAGGTGSGGSGGGSGGIGSGALHLGQNPNLHHHHHHHHHGNNGGGNG 138 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 3.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 211 GDISGGCGSTGSHFNPENKEHGHPSDE 291 G GG G+TG+ +N+ + H + E Sbjct: 569 GRAGGGVGATGAEKQQQNRSNHHRTTE 595 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.8 bits (49), Expect = 3.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 429 LMISAALTTQIREKPATLVDASPAVSSEYCKTSLYL 536 L +S A TTQ+R +D + A + + CK Y+ Sbjct: 153 LFVSLA-TTQVRRLRRRALDCTGAPNEQCCKQKFYV 187 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 124 LLDSDGHQRIVDYHADHHTGFNA 146 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNA 138 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNA 138 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNA 138 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNA 138 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 124 LLDSDGHQRIVDYHADHHTGFNA 146 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 148 LLDSDGHQRIVDYHADHHTGFNA 170 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNA 138 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 124 LLDSDGHQRIVDYHADHHTGFNA 146 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNA 138 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 124 LLDSDGHQRIVDYHADHHTGFNA 146 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNA 138 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 6.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 336 LLQQD*YDRPASRHLPEHTGFSA 404 LL D + R H HTGF+A Sbjct: 124 LLDSDGHHRIVDYHADHHTGFNA 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,621 Number of Sequences: 2352 Number of extensions: 14101 Number of successful extensions: 65 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -