BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M24 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) 62 3e-10 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) 60 2e-09 SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) 58 5e-09 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 58 5e-09 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 56 3e-08 SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 56 3e-08 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 56 3e-08 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 52 3e-07 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 52 4e-07 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45| Best HMM Match : Pkinase (HMM E-Value=0) 50 2e-06 SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) 48 9e-06 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 47 2e-05 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 46 4e-05 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 45 5e-05 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 45 6e-05 SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) 44 9e-05 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 44 1e-04 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 44 1e-04 SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) 44 1e-04 SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.001 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 40 0.001 SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.001 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 40 0.002 SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) 39 0.003 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.004 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.004 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) 38 0.006 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 38 0.006 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) 38 0.006 SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) 38 0.007 SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) 38 0.010 SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 38 0.010 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.010 SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) 37 0.013 SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) 37 0.013 SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) 37 0.013 SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) 37 0.017 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 37 0.017 SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 36 0.030 SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) 36 0.039 SB_37868| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53447| Best HMM Match : DUF924 (HMM E-Value=3.6e-17) 35 0.052 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 35 0.052 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 35 0.052 SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) 34 0.091 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 34 0.091 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 34 0.091 SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) 34 0.091 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.12 SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 34 0.12 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 34 0.12 SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_6891| Best HMM Match : Bac_chlorC (HMM E-Value=3.7) 33 0.16 SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) 33 0.16 SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.21 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 33 0.28 SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) 32 0.37 SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) 32 0.37 SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) 32 0.37 SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) 32 0.37 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) 32 0.37 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 32 0.37 SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) 32 0.37 SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) 32 0.37 SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) 32 0.49 SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) 32 0.49 SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_33599| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) 31 0.64 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 31 0.64 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 31 0.64 SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) 31 0.64 SB_37212| Best HMM Match : zf-C2H2 (HMM E-Value=2e-23) 31 0.64 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 31 0.85 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) 31 0.85 SB_5853| Best HMM Match : Pkinase (HMM E-Value=3.6e-05) 31 0.85 SB_4359| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 31 0.85 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 1.1 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 31 1.1 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 31 1.1 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 31 1.1 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 30 1.5 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 1.5 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 1.5 SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) 30 1.5 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 30 2.0 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_59772| Best HMM Match : dDENN (HMM E-Value=1.6e-24) 30 2.0 SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) 30 2.0 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) 29 2.6 SB_57129| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 2.6 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 29 3.4 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 29 3.4 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 29 3.4 SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 3.4 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) 29 3.4 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 3.4 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 4.5 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 29 4.5 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 4.5 SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_1299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) 29 4.5 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 4.5 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 28 6.0 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 6.0 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 28 6.0 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 28 6.0 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 28 6.0 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 28 6.0 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 28 6.0 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 28 6.0 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 28 6.0 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 28 6.0 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 28 6.0 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 28 6.0 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 28 6.0 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 6.0 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 28 6.0 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) 28 6.0 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 28 6.0 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 28 6.0 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 28 6.0 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 28 6.0 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 28 6.0 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 28 6.0 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 28 6.0 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 28 6.0 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 28 6.0 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 28 6.0 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 28 6.0 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 28 6.0 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 28 6.0 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 28 6.0 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 28 6.0 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 28 6.0 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 28 6.0 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 28 6.0 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 28 6.0 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 28 6.0 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 28 6.0 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 28 6.0 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 28 6.0 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 105 bits (251), Expect = 4e-23 Identities = 59/127 (46%), Positives = 82/127 (64%), Gaps = 4/127 (3%) Frame = +3 Query: 78 FEDTDKSTCLRE-INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKP 254 FED ++ + E + GG LL I++ +F+E +A+ +V +I +AL FLH +G+AHRDLKP Sbjct: 162 FEDRERFYLIFEKMRGGPLLKHIEKRKFFTEKEASLVVNDICSALDFLHKQGIAHRDLKP 221 Query: 255 ENILCVYRIGL-PVKICDFDLGGDQFHLESSEPVATPQLMTPVGSA-ILAPSGV-CSRAR 425 ENILC + + PVKICDFDL L + PV TP+L TPVGSA +AP V + + Sbjct: 222 ENILCSHENKVSPVKICDFDLASGIGGL--TTPVTTPELQTPVGSAEYMAPEVVDAFKTQ 279 Query: 426 RHAYDKR 446 YDK+ Sbjct: 280 ASTYDKK 286 Score = 74.5 bits (175), Expect = 7e-14 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +2 Query: 476 LLLCGYPPFRADCGADCGWERGENCRACQELLFNSIQEGRYTFPPR 613 ++L GYPPF CG+ CGWERGE CR CQE+L + IQEG Y FP + Sbjct: 298 IMLSGYPPFYGKCGSKCGWERGETCRTCQEMLLHRIQEGIYEFPEK 343 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 64.9 bits (151), Expect = 6e-11 Identities = 42/93 (45%), Positives = 53/93 (56%), Gaps = 8/93 (8%) Frame = +3 Query: 114 INGGQLLGRIQEHHY--FSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGL 287 I GG+LLG I+ H SE QA IVR+I +ALH LH +G+ HRDLK ENIL + Sbjct: 96 IPGGELLGLIRSHQESRLSETQARPIVRQIVSALHHLHEQGIVHRDLKMENIL-LDESKK 154 Query: 288 PVKICDFDL-----GGDQFHLESSEP-VATPQL 368 +KI DF L GG+ + P A P+L Sbjct: 155 TIKIVDFGLSNKYSGGELLKTQCGSPEYAAPEL 187 >SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) Length = 284 Score = 62.5 bits (145), Expect = 3e-10 Identities = 37/90 (41%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRI-GLP 290 + GG+L +I++ F+E +A + +EIA AL+ H VAHRDLKPEN+L V + L Sbjct: 1 MEGGELFEQIRKKRRFTEKEAMKFTKEIAQALYHCHSFNVAHRDLKPENLLLVDKSENLV 60 Query: 291 VKICDFDLGG-DQFHLESSEPVATPQLMTP 377 VK+ DF DQ L + P TP ++P Sbjct: 61 VKLADFGFAKVDQGDLVT--PQFTPYYVSP 88 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 62.1 bits (144), Expect = 4e-10 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 2/69 (2%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIG--L 287 + GG L + + Y+SE QA + R++ NAL +LH + + HRD+KP+N+L + RIG + Sbjct: 108 VAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLL-LKRIGNNV 166 Query: 288 PVKICDFDL 314 +K+ DF L Sbjct: 167 TIKLADFGL 175 >SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) Length = 181 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 1/89 (1%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 I+GG+L R+ + +E +AA + ++ + +H K V H DLKPENI+CV + + Sbjct: 78 ISGGELFERVVDEDCLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKPENIVCVSKDSWDI 137 Query: 294 KICDFDLGGD-QFHLESSEPVATPQLMTP 377 K+ DF L + + + + TP+ M P Sbjct: 138 KLIDFGLAQEYKEGFKMTALKGTPEFMAP 166 >SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 166 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLP- 290 + GG+LL RI +H SE +A I+ + + + FLH +GV HRDLKP NI+ G P Sbjct: 29 MRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPE 88 Query: 291 -VKICDF 308 ++I DF Sbjct: 89 SLRIVDF 95 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 58.4 bits (135), Expect = 5e-09 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLP- 290 + GG+LL RI +H SE +A I+ + + + FLH +GV HRDLKP NI+ G P Sbjct: 296 MRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPE 355 Query: 291 -VKICDF 308 ++I DF Sbjct: 356 SLRIVDF 362 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 56.4 bits (130), Expect = 2e-08 Identities = 38/128 (29%), Positives = 59/128 (46%), Gaps = 1/128 (0%) Frame = +3 Query: 75 VFEDTDKSTCLREI-NGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLK 251 VFE ++ + E+ GG LL RI +F+E A ++ + + +LH G+ HRDLK Sbjct: 133 VFECKNRVYLVMELATGGVLLDRILSKGFFTERDATRVIYMVLEGVRYLHSLGITHRDLK 192 Query: 252 PENILCVYRIGLPVKICDFDLGGDQFHLESSEPVATPQLMTPVGSAILAPSGVCSRARRH 431 PEN+L Y G KI D G + TP +AP + S+ + Sbjct: 193 PENLL-YYHPGNDSKIMITDFGLSNLRKHPDDRTMETTCGTP---GYMAPEVLLSKPYTN 248 Query: 432 AYDKRWTV 455 + D W++ Sbjct: 249 SVD-IWSI 255 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 56.0 bits (129), Expect = 3e-08 Identities = 30/77 (38%), Positives = 45/77 (58%) Frame = +3 Query: 78 FEDTDKSTCLREINGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPE 257 ++DT L G+L + F E +AA+ +R++A+AL + H K V HRD+KPE Sbjct: 97 YDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPE 156 Query: 258 NILCVYRIGLPVKICDF 308 N+L Y+ G +KI DF Sbjct: 157 NLLLNYK-G-DIKIADF 171 >SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 56.0 bits (129), Expect = 3e-08 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPEN 260 GG+LL RI++ F+E A+ I+R+I +A+ F+H +GV HRDLKPE+ Sbjct: 352 GGELLERIRKKKMFTESAASVIMRKIVSAVEFMHQRGVVHRDLKPES 398 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLH 221 +NGG+L + + F+E + + EI AL LH Sbjct: 119 VNGGELFTHLYQREKFTEDEVRLYIGEIVVALDHLH 154 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYR-IGLP 290 + GG+L I Y+SE A+ ++++ ++ H G+ HRDLKPEN+L R G Sbjct: 96 VTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAM 155 Query: 291 VKICDFDL 314 VK+ DF L Sbjct: 156 VKLADFGL 163 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 55.6 bits (128), Expect = 3e-08 Identities = 29/77 (37%), Positives = 42/77 (54%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 + GG+L RI E ++E A+ +V++I A +LH G+ HRDLKPEN+L Y Sbjct: 91 VQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLL-YYSPDEDS 149 Query: 294 KICDFDLGGDQFHLESS 344 KI D G + + S Sbjct: 150 KIMISDFGLSKIEAQGS 166 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 440 QALDCGR-SA*SRLLLCGYPPFRADCGAD 523 +A+DC + +LLCGYPPF D A+ Sbjct: 190 KAVDCWSIGVITYILLCGYPPFYDDSDAN 218 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 126 QLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYR-IGLPVKIC 302 +++ R+ +SE A+ +R++ A+ F H G+ HRDLKP N+L R P+K+ Sbjct: 9 EIVNRVNAGFVYSEAVASHYMRQVLEAVSFCHENGIIHRDLKPHNVLLANRENSAPIKVA 68 Query: 303 DFDLGGD--QFHLESSEPVATPQLMTP 377 DF + + +S + TP M+P Sbjct: 69 DFGVAVELPPEGCITSGRLGTPHFMSP 95 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 52.8 bits (121), Expect = 2e-07 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 5/72 (6%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLP- 290 + GG L I E ++E A+ +VR++A+AL +LH + HRD+KPEN+L + LP Sbjct: 98 VKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENLLV---LNLPN 154 Query: 291 ----VKICDFDL 314 +K+ DF L Sbjct: 155 GRKSLKLADFGL 166 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 52.4 bits (120), Expect = 3e-07 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 5/91 (5%) Frame = +3 Query: 120 GGQLLGRIQEHH-YFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVK 296 GG LL + ++ F E A + EI A+H LH G HRD+KP+N+L + R G +K Sbjct: 163 GGDLLSLLSKYDDIFEEDMARFYLAEIVMAIHSLHTMGFVHRDVKPDNVL-IDRTG-HIK 220 Query: 297 ICDFD----LGGDQFHLESSEPVATPQLMTP 377 + DF L D+ + S PV TP+ + P Sbjct: 221 LADFGSSARLSADK-KVFSKMPVGTPEYIAP 250 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 52.0 bits (119), Expect = 4e-07 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Frame = +3 Query: 75 VFEDTDKST----CLREINGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHR 242 +FED D +T + I GG L I F+E A R++ AL +LH + + HR Sbjct: 508 LFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFRDMCKALAYLHKRKIVHR 567 Query: 243 DLKPENILCVYRIG--LPVKICDFDL 314 DLKPEN+L R +K+ DF L Sbjct: 568 DLKPENLLVHKRSDGQTHLKLADFGL 593 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/55 (36%), Positives = 32/55 (58%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYR 278 ++GG+L +I +E + +R+I + +H K + H DLKPEN+LCV R Sbjct: 130 VSGGELFEKICNDDNLTEKEVIRYMRQILQGVEHMHRKSIVHLDLKPENVLCVIR 184 >SB_45| Best HMM Match : Pkinase (HMM E-Value=0) Length = 851 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +3 Query: 189 REIANALHFLHGKGVAHRDLKPENILCVYRIGLP-VKICDFDLGGDQFHLESSEPV 353 +++ + LH+LHGK + HRDLKP N+L ++ P +KI DF L D S V Sbjct: 573 KDLVDGLHYLHGKSILHRDLKPNNLLYHFQDETPRLKIADFGLSKDTTSASQSSTV 628 >SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 2/46 (4%) Frame = +3 Query: 135 GRIQEH--HYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 G + +H F P+A IV+++A+ L +HGKG+ HRD+KP NIL Sbjct: 93 GDLAQHKGEVFDLPRALSIVQQVASGLAVVHGKGLVHRDIKPANIL 138 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 69 H*VFEDTDKSTCLRE-INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRD 245 H F+ D + E +NGG L+ IQ F E ++ EI L FLH G+ +RD Sbjct: 352 HSAFQSADHLFFVMEYLNGGDLMFHIQNQGKFDEKRSRFYAAEIVCGLQFLHELGIIYRD 411 Query: 246 LKPENILCVYRIGLPVKICDFDL 314 LK +N+L + + G +K+ DF + Sbjct: 412 LKLDNVL-LDKDG-HIKLADFGM 432 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Frame = +3 Query: 84 DTDKSTCL--REINGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPE 257 +TDK+ L +GG++ + H E +A R+I +A+ + H K V HRDLK E Sbjct: 150 ETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAE 209 Query: 258 NILCVYRIGLPVKICDFDLGGD 323 N+L + +KI DF + Sbjct: 210 NLL--LDADMNIKIADFGFSNE 229 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 46.0 bits (104), Expect = 3e-05 Identities = 29/86 (33%), Positives = 45/86 (52%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKI 299 GG+L ++ F+ EI +A+ +LHG + +RDLKPENIL + R G VK+ Sbjct: 123 GGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENIL-LDRDG-HVKL 180 Query: 300 CDFDLGGDQFHLESSEPVATPQLMTP 377 DF + H ++ TP+ + P Sbjct: 181 TDFGF-AKEVHDKTWTLCGTPEYLAP 205 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 45.6 bits (103), Expect = 4e-05 Identities = 29/73 (39%), Positives = 38/73 (52%) Frame = +3 Query: 90 DKSTCLREINGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILC 269 D+ + E G L I H SE Q A + R + AL FLH +GV HRD+K ++IL Sbjct: 286 DELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILL 345 Query: 270 VYRIGLPVKICDF 308 G VK+ DF Sbjct: 346 TSN-G-TVKLSDF 356 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/48 (43%), Positives = 32/48 (66%) Frame = +3 Query: 165 EPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDF 308 E +++ ++ A+ F+H + HRD+KPENIL V R G+ VK+CDF Sbjct: 44 ENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENIL-VSRSGI-VKLCDF 89 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 44.8 bits (101), Expect = 6e-05 Identities = 33/88 (37%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKI 299 GG L + E E Q A + RE AL FLH GV HRD+K +NIL + VK+ Sbjct: 301 GGSLTDVVTET-CMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNIL--LGMDGQVKL 357 Query: 300 CDFDLGG--DQFHLESSEPVATPQLMTP 377 DF + S V TP M P Sbjct: 358 TDFGFCATITPEQNKRSTMVGTPYWMAP 385 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/51 (43%), Positives = 30/51 (58%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 ++GG L+ +Q E A EI AL+FLH KGV +RDLK +N+L Sbjct: 106 VSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVL 156 >SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) Length = 290 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/50 (42%), Positives = 30/50 (60%) Frame = +3 Query: 117 NGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 + G LL I+ + E +A ++ +A+ +LH KGV HRDLK ENIL Sbjct: 73 DNGDLLEYIRSNGAIPENEARLFYHQLVDAVEYLHNKGVVHRDLKCENIL 122 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/42 (47%), Positives = 30/42 (71%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLG 317 +I NA++F H + + HRDLKP+N+L + GL +K+ DF LG Sbjct: 217 QITNAIYFCHARRILHRDLKPQNLL-IDSKGL-IKLADFGLG 256 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 44.0 bits (99), Expect = 1e-04 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +3 Query: 75 VFEDTDKSTCLREI-NGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLK 251 V E + + + E+ G LL +Q+ E +A +I ++I + H KG+AHRDLK Sbjct: 135 VLESSKRFYLVLELAQNGDLLQLLQKKKQLHENEARKIFKKIVKGVLHCHRKGIAHRDLK 194 Query: 252 PENILCVYRIGLPVKICDF 308 ENIL + R P+ I DF Sbjct: 195 LENIL-LSRKNEPI-ISDF 211 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +3 Query: 123 GQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 G LL I+ H +E + + R+I +H++H + + HRDLK EN+L Sbjct: 135 GDLLEYIRTHGALTEKASRRLFRQITAGVHYIHSQDIVHRDLKCENLL 182 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/67 (32%), Positives = 35/67 (52%) Frame = +3 Query: 117 NGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVK 296 N G++ + H E +A + +I +A+ + H + V HRDLK EN+L + +K Sbjct: 237 NNGEMFDYLAHHGRLPEKEARKKFVQILSAVDYCHKRHVVHRDLKAENLLLDQNMN--IK 294 Query: 297 ICDFDLG 317 I DF G Sbjct: 295 IADFGFG 301 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 GG L+ I E + + +R+I +A+ +LH G+ HRDLK EN+L Sbjct: 264 GGDLMDYICYRKRLGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLL 312 >SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) Length = 331 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +3 Query: 162 SEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYR 278 SE ++R++ + LH G+ HRDLKP NI+ VYR Sbjct: 110 SEQDCIAVIRDVVAGMKHLHDNGIVHRDLKPGNIMRVYR 148 >SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 204 ALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGD-QFHLESSEPVATPQLMTP 377 AL ++HG + H DLKPENI+C +K+ DF L + + E TP + P Sbjct: 460 ALDYMHGNNIVHLDLKPENIMCESINSNQIKLVDFGLARELKKDEEVKSSFGTPDFVAP 518 >SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/34 (52%), Positives = 25/34 (73%) Frame = +3 Query: 165 EPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 E +A R+I +A+ ++H KG AHRDLKPEN+L Sbjct: 150 EDEARGFFRQIISAVAYIHEKGYAHRDLKPENLL 183 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/67 (34%), Positives = 37/67 (55%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 + GG L+ + + F E A + E+ A+ +H G HRD+KP+NIL + + G + Sbjct: 736 VPGGDLMSLLIKFGIFPEDYAKFYIAELVLAIDSVHRMGFVHRDIKPDNIL-IDKDG-HI 793 Query: 294 KICDFDL 314 K+ DF L Sbjct: 794 KLTDFGL 800 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Frame = +3 Query: 171 QAAEIVREIANALHFLHGKGVAHRDLKPENIL---CVYRIGLP-VKICDF 308 Q E I AL +LH K + H DLKPEN+L G P VK+CDF Sbjct: 588 QMFETQERILLALKYLHSKNIVHCDLKPENVLLAPITSECGYPAVKLCDF 637 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 ++ +I L F+H G HRD+KPEN+LC VKI DF L Sbjct: 71 VIYQILQGLAFIHKHGYFHRDMKPENLLCTGH--ELVKIADFGL 112 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/45 (46%), Positives = 29/45 (64%) Frame = +3 Query: 180 EIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 ++ +I N + FLH + HRD+KP+NIL V + G VKI DF L Sbjct: 117 DLTYQILNGVDFLHTHRIVHRDIKPQNIL-VTKDG-QVKIADFGL 159 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/65 (33%), Positives = 35/65 (53%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 ++G +L + +E AA ++R I NAL +LH + H D++P NI+ G V Sbjct: 126 LDGEDVLKFMSSKTKVTEEDAALVIRGILNALCYLHELNIVHLDIRPANIMVQ---GSDV 182 Query: 294 KICDF 308 K+ DF Sbjct: 183 KLIDF 187 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/60 (36%), Positives = 31/60 (51%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKI 299 GG L I E A + +R++A AL ++ VAH DLKP+N+L R +KI Sbjct: 139 GGDLSRFIHSKRALPERMARKFLRQLACALQYMRSYDVAHMDLKPQNLLLSSRHNPVLKI 198 >SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 + +I NA+ + H +G+ HRDLKP NI + + VK+ DF L Sbjct: 770 VFEQIVNAVEYFHNRGMMHRDLKPSNIF--FSLDGLVKVGDFGL 811 >SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) Length = 492 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/91 (28%), Positives = 41/91 (45%) Frame = +3 Query: 36 DPRAAGAHNPAH*VFEDTDKSTCLREINGGQLLGRIQEHHYFSEPQAAEIVREIANALHF 215 D HN F+DTD ++E+ L +Q + + + ++ L + Sbjct: 79 DCEGKSIHNGDAENFKDTDYVYLVQEVMETNLHTILQSNSSLGQDYTKLFLYQLLRGLKY 138 Query: 216 LHGKGVAHRDLKPENILCVYRIGLPVKICDF 308 +H V HRD+KP N+L V L +KI DF Sbjct: 139 IHSANVLHRDIKPSNLL-VDSETLMLKIGDF 168 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 4/46 (8%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENILCVYRIG----LPVKICDF 308 I +IA+AL +LH GV +RDLKPENIL V+ + L VK+ DF Sbjct: 1619 IAYQIADALAYLHTLGVIYRDLKPENIL-VWSLNEGDDLYVKLIDF 1663 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +3 Query: 84 DTDKSTCL--REINGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPE 257 +T K C+ + GG ++ A E A+ +LH G+ HRD+KP+ Sbjct: 27 ETKKHLCMVMEYVEGGDCASLLKNIGALPADLARMYFAETVLAVEYLHSYGIVHRDIKPD 86 Query: 258 NILCVYRIGLPVKICDFDL 314 N+L + +G +K+ DF L Sbjct: 87 NLL-ITSLG-HIKLTDFGL 103 >SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/43 (46%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = +3 Query: 192 EIANALHFLHGKG--VAHRDLKPENILCVYRIGLPVKICDFDL 314 +IA+ L +LHG ++HRDLKP+NIL R + +K+ DF L Sbjct: 172 QIASGLMYLHGLSPPISHRDLKPDNILLDKR-SMRIKLADFGL 213 >SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) Length = 683 Score = 39.1 bits (87), Expect = 0.003 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQFHLES-SEPVAT 359 I+ I A+ ++H V HRDLKPENIL I VKI DF + E+ E T Sbjct: 600 IMLSIFEAVDYMHYHNVVHRDLKPENILLDEEIN--VKISDFGFAVELKEGETLRELCGT 657 Query: 360 PQLMTP 377 P + P Sbjct: 658 PGYLAP 663 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/63 (33%), Positives = 32/63 (50%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKI 299 GG + + ++ F E +R+I + +LH V HRD+K NIL V G ++I Sbjct: 699 GGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANIL-VDSTGQDIRI 757 Query: 300 CDF 308 DF Sbjct: 758 ADF 760 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 38.7 bits (86), Expect = 0.004 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 12/88 (13%) Frame = +3 Query: 87 TDKSTCLREINGGQLLGRIQEH---------HY---FSEPQAAEIVREIANALHFLHGKG 230 TD + ++GG+L I +H H+ E A ++I + + + H Sbjct: 91 TDIFMVMEYVSGGELFEYILKHGKVQCDKTSHFKVQLEEKDARRFFQQIISGVDYCHRHM 150 Query: 231 VAHRDLKPENILCVYRIGLPVKICDFDL 314 V HRDLKPEN+L + L +KI DF L Sbjct: 151 VVHRDLKPENLLLDSQ--LNIKIADFGL 176 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 38.3 bits (85), Expect = 0.006 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = +3 Query: 162 SEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQFHL-- 335 +EP+ + R++ L FLH V HRDLK N+L VK+ DF + Sbjct: 327 NEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGNLLLASDGN--VKMADFGVSAKNKKTLQ 384 Query: 336 ESSEPVATPQLMTP 377 + S + TP M P Sbjct: 385 KRSTFIGTPYWMAP 398 >SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) Length = 196 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 4/66 (6%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLG----GDQFHLESSEPVAT 359 ++ A++ +H +G+ H DLKP N L V + +K+ DF + GDQ ++ + T Sbjct: 43 QMLRAVNVIHERGIVHSDLKPANFLFV---DVQLKLIDFGIANAIQGDQTSIQRDTQIGT 99 Query: 360 PQLMTP 377 M P Sbjct: 100 LNFMAP 105 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 + GG + ++ F EP R+I + + +LH V HRD+K NI+ + G+ + Sbjct: 261 VPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPN-GV-I 318 Query: 294 KICDF 308 K+ DF Sbjct: 319 KLIDF 323 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 ++REI L +H +G+ HRDLKP NI G +K+ DF L Sbjct: 1079 LLREIVEGLAHIHSQGIIHRDLKPVNIF--LDAGGHIKLGDFGL 1120 >SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) Length = 280 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 +I L ++H V HRDLKP N+L +KICDF L Sbjct: 21 QILRGLKYIHSANVLHRDLKPSNLL--LNTTCDLKICDFGL 59 >SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) Length = 256 Score = 37.9 bits (84), Expect = 0.007 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = +3 Query: 195 IANALHFLHGKGVAHRDLKPENIL 266 +A+ALHF+HG+G H DLK N++ Sbjct: 187 VADALHFIHGRGFVHNDLKGNNVV 210 >SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) Length = 268 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 138 RIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 +IQ E A +I R++ + +L +G+ H D+KPENIL Sbjct: 149 QIQPQGRVKEKVARKIFRDVMRGVDYLDKRGILHNDIKPENIL 191 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 GG L+ + + F+E + + E A+ +H G HRD+KP+N+L Sbjct: 132 GGDLMTLLMKKDTFTEEETRFYIAEALLAIDSIHQLGFIHRDIKPDNLL 180 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 37.5 bits (83), Expect = 0.010 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 2/105 (1%) Frame = +3 Query: 69 H*VFEDTDKSTCLREINGGQLLGRIQEHHY-FSEPQAAEIVREIANALHFLHGKGVAHRD 245 H FED D L E+ + L + + +EP+ +++I +A +LH + HRD Sbjct: 104 HGYFEDRDYIYILLELCPRRSLMELHKRRRALTEPEVRYFMKQIIDACIYLHKSRIIHRD 163 Query: 246 LKPENILCVYRIGLPVKICDFDLGGDQFHLESSEPV-ATPQLMTP 377 LK N+ + VK+ DF L E + + TP + P Sbjct: 164 LKLGNLF--LNDDMEVKVGDFGLATRAEEGERKKTLCGTPNYIAP 206 >SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 37.5 bits (83), Expect = 0.010 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +3 Query: 165 EPQAAEIVREIANALHFLHGK-GVAHRDLKPENILCVYRIGLPVKICDFDLGG 320 E +I + +AL +LH V HRD+KP NIL R K+CDF + G Sbjct: 127 EEVLGKIAVSVVSALEYLHSNLKVIHRDVKPSNILVDERGNF--KLCDFGISG 177 >SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) Length = 282 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENIL 266 EI+NAL ++H G+ H DLKP N+L Sbjct: 127 EISNALVYIHNSGIVHLDLKPANVL 151 >SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) Length = 239 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 141 IQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 IQ E A +I R++ + +L +G+ H D+KPENIL Sbjct: 58 IQPQGRVKEKVARKIFRDVMRGVDYLDKRGILHNDIKPENIL 99 >SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) Length = 2056 Score = 37.1 bits (82), Expect = 0.013 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = +3 Query: 177 AEIVREIANALHFLHGKGVAHRDLKPENILC--VYRIGLPVKICDFDLGGDQF-HLESSE 347 A +++E A L +LH KG+ H D+K NIL VK+ DF +F +S Sbjct: 309 AFVIKEAAKGLSYLHNKGIVHSDIKTCNILVGESSSEAYKVKLGDFGAAHYEFRQFSTST 368 Query: 348 PVATPQLMTPVGSA 389 + + T +G+A Sbjct: 369 TSCSMEAQTVIGTA 382 >SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 37.1 bits (82), Expect = 0.013 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENI 263 GG+L +I E A ++ ++ +A+ +H + HRDLK EN+ Sbjct: 142 GGELFAKISNEGKLPERIAKKLYGQVLSAVEHMHDNDIIHRDLKAENV 189 >SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 141 IQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 IQ E A +I R++ + +L +G+ H D+KPENIL Sbjct: 508 IQPRGRVKEKGARKIFRDVMRGVKYLDQRGILHNDIKPENIL 549 >SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) Length = 592 Score = 37.1 bits (82), Expect = 0.013 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 162 SEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVY-RIGLPVKICDFDL 314 SE + ++R+I + LH + H D+KP NIL + I +KI DF L Sbjct: 250 SEKEVVYLLRQILEGIRHLHKQNYVHLDIKPNNILLMTDEIYPEIKIIDFGL 301 >SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 37.1 bits (82), Expect = 0.013 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = +3 Query: 177 AEIVREIANALHFLHGKGVAHRDLKPENILC--VYRIGLPVKICDFDLGGDQF-HLESSE 347 A +++E A L +LH KG+ H D+K NIL VK+ DF +F +S Sbjct: 290 AFVIKEAAKGLSYLHNKGIVHSDIKTCNILVGESSSEAYKVKLGDFGAAHYEFRQFSTST 349 Query: 348 PVATPQLMTPVGSA 389 + + T +G+A Sbjct: 350 TSCSMEAQTVIGTA 363 >SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) Length = 481 Score = 36.7 bits (81), Expect = 0.017 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENIL 266 ++ +I + +H+LH V HRDLKP NIL Sbjct: 26 LLYQILDGIHYLHSNWVLHRDLKPANIL 53 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 36.7 bits (81), Expect = 0.017 Identities = 23/69 (33%), Positives = 36/69 (52%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 + GG L ++ + E A I+RE+ L +LH + HRD+K N+L + G V Sbjct: 890 LGGGSALDLMKAGN-IEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVL-MSETG-DV 946 Query: 294 KICDFDLGG 320 K+ DF + G Sbjct: 947 KLADFGVAG 955 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 36.7 bits (81), Expect = 0.017 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 GG + +Q+ E + + E+ AL +L K + HRDLKP+N+L Sbjct: 4193 GGDIRYHLQQGMRVDENRVKLYICELGLALGYLRSKKIVHRDLKPDNML 4241 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 108 REINGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 +E GG + +++ E + V +I L FLHG + HRDLK NIL Sbjct: 9 KENVGGSISQLLRDKGPLVEETVRQYVWQILKGLSFLHGVNIIHRDLKGANIL 61 >SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENIL 266 +IA L + H KG+AH DLKP N+L Sbjct: 143 DIARGLDYAHAKGIAHLDLKPGNVL 167 >SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/39 (35%), Positives = 26/39 (66%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDF 308 ++ +L ++H G+ HRD+KP+N+L + +K+CDF Sbjct: 170 QLFRSLTYIHCLGICHRDIKPQNLLLDPETAV-LKLCDF 207 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.030 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -3 Query: 89 RVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 R FE S+S+ +CSPG +++ PPPRWSS Sbjct: 2 RFFEGSLSYQSNSCSPGDPLVLERPPPRWSS 32 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 35.9 bits (79), Expect = 0.030 Identities = 29/98 (29%), Positives = 38/98 (38%) Frame = -2 Query: 543 SPRSHPQSAPQSARNGGYPQSRRRDHAERPQSSACRRRAAEPANRHHSGPE*RYQPVS*A 364 SPR + +P R RRR + S+ RR+ P +R PE R + Sbjct: 813 SPRDQRRRSPMRRRRSRDASPRRRRRSASGSDSSPHRRSESPRDRRRRSPEHRRR----R 868 Query: 363 EAWPRAR*TRGETDPLRDRSRIS*PADRSGTRTVCSPA 250 EA P R + P R R R P R R SP+ Sbjct: 869 EASPPRRDRKRYDSPPRRRRRSPSPPPRRRRRDSYSPS 906 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 191 RDSERPALPPRQGRRAPGPEAGEHTVRVPDRS 286 RDS P+ PPR+ R++P P R P S Sbjct: 910 RDSPTPSPPPRRRRKSPSPSPPRRRRRSPSNS 941 Score = 29.5 bits (63), Expect = 2.6 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 3/82 (3%) Frame = -2 Query: 537 RSHPQSAPQSARNGGYPQSRRRDHAERPQSSACRRR---AAEPANRHHSGPE*RYQPVS* 367 R P P+ R Y SRRR + P RRR + P R P P+ Sbjct: 888 RRSPSPPPRRRRRDSYSPSRRRRDSPTPSPPPRRRRKSPSPSPPRRRRRSPSNSPPPMRS 947 Query: 366 AEAWPRAR*TRGETDPLRDRSR 301 + P R R T P R+R Sbjct: 948 SPLPPPQR-KRASTPPSPRRAR 968 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 35.9 bits (79), Expect = 0.030 Identities = 25/77 (32%), Positives = 40/77 (51%) Frame = +3 Query: 114 INGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 ++GG + + + E +++ I AL +LH KGV H DLK N+L + G+ V Sbjct: 420 MDGGSVEMFLSNNGSADEDSVKCVMQVILEALCWLHSKGVVHLDLKGGNVLMDSK-GI-V 477 Query: 294 KICDFDLGGDQFHLESS 344 K+ DF G HL+ + Sbjct: 478 KLADF---GASVHLDDT 491 >SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) Length = 181 Score = 35.5 bits (78), Expect = 0.039 Identities = 23/66 (34%), Positives = 36/66 (54%) Frame = +3 Query: 180 EIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQFHLESSEPVAT 359 EI+ ++A AL +LH + HRD+K +N+L + + DF L + +E+S V T Sbjct: 20 EILLDVARALKYLHSLDLIHRDVKLQNVLVDEK--SQGSLTDFGLCKAEGVMENS-LVGT 76 Query: 360 PQLMTP 377 P M P Sbjct: 77 PTSMAP 82 >SB_37868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 35.5 bits (78), Expect = 0.039 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +3 Query: 159 FSEPQAAEIVREIANALHFLHGKGVAHRDLKPE 257 F+E + E+A AL LHG G+ +RDLKPE Sbjct: 3 FTEEDVKFYLAELALALDHLHGLGIIYRDLKPE 35 >SB_53447| Best HMM Match : DUF924 (HMM E-Value=3.6e-17) Length = 585 Score = 35.1 bits (77), Expect = 0.052 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +3 Query: 177 AEIVREIANALHFLHGKG--VAHRDLKPENIL 266 A+ VRE+A AL FLH + V HR L P NIL Sbjct: 288 AKFVREVAEALSFLHSRDPPVVHRYLTPRNIL 319 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 35.1 bits (77), Expect = 0.052 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +3 Query: 84 DTDKSTC--LREINGGQLLGRIQE--HHYFSEPQAAEIVREIANALHFLHGKGVAHRDLK 251 +T + C L +NGG L + + F E +A ++ L LH + + +RDLK Sbjct: 153 ETKDALCMVLTLMNGGDLKFHVHNMGNPGFEEERAVFYAAQVTLGLIHLHSQRIVYRDLK 212 Query: 252 PENIL 266 PEN+L Sbjct: 213 PENLL 217 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 ++ A+ + H V HRD+KPEN+L + + + +K+CDF + Sbjct: 133 QLIKAIKWCHQNDVIHRDIKPENLL-ISKTDI-LKLCDFGI 171 >SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 165 EPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 E +A R+I A+ + H V HRDLKPEN++ Sbjct: 14 EEKARYFFRQIVLAIDYCHKLHVVHRDLKPENVI 47 >SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) Length = 251 Score = 34.3 bits (75), Expect = 0.091 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = +3 Query: 96 STCLREINGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 STC GG L+ + ++ E A E+ AL +H G HRD+KP+N+L Sbjct: 116 STC----KGGDLVN-LMSNYEIPEKWAKFYCAEVVLALDAIHTMGFVHRDVKPDNML 167 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 34.3 bits (75), Expect = 0.091 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +3 Query: 159 FSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 F + A+I +IA + +LH +G+ H DL+ +N+ + I DF L Sbjct: 108 FPLAKIAQITTQIAQGMGYLHARGIVHTDLRSKNVF--LELNSKAVITDFGL 157 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 34.3 bits (75), Expect = 0.091 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 162 SEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 SE Q ++++ + L LH + HRD+KP N+L Sbjct: 285 SELQPLTVLQQATSGLAHLHSLNIVHRDIKPHNVL 319 >SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) Length = 956 Score = 34.3 bits (75), Expect = 0.091 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 10/64 (15%) Frame = +3 Query: 105 LREINGGQLLGRIQEH----------HYFSEPQAAEIVREIANALHFLHGKGVAHRDLKP 254 +R +NGG +L I++ E A ++RE+ L + H G+ HRD+K Sbjct: 772 MRLLNGGSMLDVIKQRIKQQPGLVDEGVLEEDIIATVLREVLKGLEYFHKNGLIHRDVKA 831 Query: 255 ENIL 266 NIL Sbjct: 832 GNIL 835 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENILCVYRIGLP--VKICDF 308 IV+++ AL L G+ H DLKPENI+ V P VK+ DF Sbjct: 203 IVQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFRVKVIDF 246 >SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 591 Score = 33.9 bits (74), Expect = 0.12 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +3 Query: 144 QEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL-CVYRIGLPVKICDFDLGG 320 QE ++ R+IA + +L K HRDL NIL C + VKI DF L Sbjct: 497 QEGRELTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILICEDNL---VKISDFGLTR 553 Query: 321 DQFHLESSE 347 D + ESSE Sbjct: 554 DVY--ESSE 560 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 123 GQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLK-PEN 260 GQL +++ + +IA+ +H+LHG + HRDLK P+N Sbjct: 182 GQLFEVLRDGREITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPKN 228 >SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -3 Query: 80 EDSMSWIMCACSPG--IIV*TPPPRWSS 3 +D + W +CSPG +++ PPPRWSS Sbjct: 57 DDYLDWTSNSCSPGDPLVLERPPPRWSS 84 >SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENIL 266 +I AL +H K +AH DLKP NI+ Sbjct: 178 DITKALEAIHNKNIAHLDLKPSNII 202 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/71 (25%), Positives = 34/71 (47%) Frame = +3 Query: 165 EPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQFHLESS 344 E + +++ +AL ++H + HRDLK NI VK+ DF + +++ Sbjct: 126 EKDILNMFQQMLSALKYIHNNNILHRDLKTANIFLTK--DTVVKLGDFGISKQLEGSKAN 183 Query: 345 EPVATPQLMTP 377 + TP ++P Sbjct: 184 TVLGTPYYISP 194 >SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 33.5 bits (73), Expect = 0.16 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 204 ALHFLHGKGVAHRDLKPENIL 266 AL F H +G+ HRD+KP N++ Sbjct: 473 ALDFCHSRGIMHRDVKPHNVM 493 >SB_6891| Best HMM Match : Bac_chlorC (HMM E-Value=3.7) Length = 433 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 491 YPPFRADCGA--DCGWERGENCRACQELLFNSIQEGRYTFPPRGGS 622 YP ++ C A W+ G + R C + ++G + PPRGG+ Sbjct: 342 YPDIKSVCAALQSTAWQTGSSARGCAPRISGGRRKGGSSAPPRGGT 387 >SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) Length = 460 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +3 Query: 117 NGGQLLGRIQEHHYF----SEPQAAEIVREIANALHFLHGKGVAHRDLKPENI 263 +GG L RIQ ++ SE ++ ++A L ++H + H D+KP NI Sbjct: 217 DGGSLADRIQSNNKLGERLSEADLKMLLLQLAQGLKYIHSLHLVHMDIKPGNI 269 >SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDF 308 +I A+ F+HG G H D+K N+L V G K+ DF Sbjct: 26 DILKAVEFMHGNGFIHNDIKGANVL-VDDKGRTAKLTDF 63 >SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/49 (44%), Positives = 26/49 (53%) Frame = +3 Query: 168 PQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 P+ E +IA A+ LH HRDL NIL V + L VKI DF L Sbjct: 961 PRLMEFCLQIAEAMEALHRDKCIHRDLAARNIL-VVKENL-VKISDFGL 1007 >SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 33.1 bits (72), Expect = 0.21 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +3 Query: 144 QEHHYFSEPQAAEIVREIANALHFLH----GKGVAHRDLKPENILCVYRIGLPVKICDFD 311 +E Y +E +++ ++ A+ H G V HRDLKP N+ + VK+ DF Sbjct: 104 REKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVF--LDANMNVKLGDFG 161 Query: 312 LGGDQFHLESSEP--VATPQLMTPVGSAI 392 L H S V TP M+P+ A+ Sbjct: 162 LARVLSHDTSFAKTFVGTPYYMSPLHMAV 190 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +3 Query: 159 FSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 FSE Q ++ ++ +LH + HRDLK N+L + G+ +KI DF L Sbjct: 132 FSEAQIKCLMIQLLEGTKYLHEHFIVHRDLKVSNLLLTGK-GV-LKIADFGL 181 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +3 Query: 186 VREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 V ++ + + + H V HRDLKP+N+L + + G +K+ DF L Sbjct: 74 VYQLLSGVAYCHSHRVLHRDLKPQNLL-IDKNG-AIKLADFGL 114 >SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = +3 Query: 126 QLLGRIQEHHYFSEPQAAE-----IVREIANALHFLHGKGVAHRDLKPENIL 266 + L R +E H P A E ++ ++ AL LH +G+ HRDL EN+L Sbjct: 1163 EFLERTREEHK-ENPDAYERNVCVLMIQLFAALDHLHSEGIVHRDLNAENLL 1213 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 WI +CSPG +++ PPPRWSS Sbjct: 973 WISNSCSPGDPLVLERPPPRWSS 995 >SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) Length = 239 Score = 32.3 bits (70), Expect = 0.37 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 156 YFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 + +E +R++ + L++ H K HRD+K NIL Sbjct: 81 HLTEDHIKSFIRQLLDGLNYCHKKNFLHRDIKCSNIL 117 >SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) Length = 1452 Score = 32.3 bits (70), Expect = 0.37 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 141 IQEHHYFSEP--QAAEIVREIANALHFLHGKGVAHRDLKPENILCV 272 +++++Y P Q I ++ A+ FLH + H DLKPEN+L V Sbjct: 799 MKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFV 844 >SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) Length = 948 Score = 32.3 bits (70), Expect = 0.37 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +3 Query: 165 EPQAAEIVR----EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 +P E VR +I L ++H V HRDLKP N+L +KI DF + Sbjct: 120 QPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLL--VNENAELKIGDFGM 171 >SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) Length = 1595 Score = 32.3 bits (70), Expect = 0.37 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +3 Query: 180 EIVREIANALHFLHGKGVAHRDLKPENIL 266 +I ++A+AL +LH + +RDLK +N+L Sbjct: 501 KIAYQVASALWYLHDSDIIYRDLKTDNVL 529 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 32.3 bits (70), Expect = 0.37 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -2 Query: 573 KRSS*QARQFSPRSHPQS-APQSARNGGYPQSRRRDHAERPQSSACRR---RAAEPANRH 406 +RS ++R SPR +S +P+ R P R H R +S + RR R+ P +R Sbjct: 220 RRSRSRSRSRSPRRRRRSRSPRRRRRSRSPSPHHRSHRSRSRSRSPRRRHSRSRSPTHRR 279 Query: 405 H 403 H Sbjct: 280 H 280 >SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 32.3 bits (70), Expect = 0.37 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENIL 266 ++ + FLH +G+ HRD+K +N+L Sbjct: 573 DVVEGIRFLHSQGLVHRDIKLKNVL 597 >SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) Length = 150 Score = 32.3 bits (70), Expect = 0.37 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +3 Query: 195 IANALHFLHGKGVAHRDLKPENILCVYRIGLPV----KICDFDLGGDQFHLESSEPVATP 362 +A L +LH + +RDLKP NIL ++ + L + KI D+ + + P TP Sbjct: 1 VAEGLAYLHKHMIVYRDLKPHNIL-IFSLSLGILINAKISDYGIARYATLYGLTAPEGTP 59 Query: 363 QLMTP 377 P Sbjct: 60 GYRAP 64 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 32.3 bits (70), Expect = 0.37 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 7/51 (13%) Frame = -3 Query: 134 QELTAVYFSKTGRLVRVFE-----DSMSWIMCACSPG--IIV*TPPPRWSS 3 ++L V FS G V++ D +++I +CSPG +++ PPPRWSS Sbjct: 23 KKLLFVLFSIVGLPVKILASKTAGDVIAFISNSCSPGDPLVLERPPPRWSS 73 >SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) Length = 184 Score = 32.3 bits (70), Expect = 0.37 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 147 EHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENI 263 E E + + + +AL F+H + +AH D+KP NI Sbjct: 136 EKEVIDESRRLKFACHLCSALEFIHEREIAHLDVKPANI 174 >SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) Length = 210 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLG 317 ++ AL +H + V HRD+KP N+ + G+ VK+ D LG Sbjct: 121 QLTAALEHMHSRRVMHRDIKPANVF-ITATGV-VKLGDLGLG 160 >SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) Length = 208 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +3 Query: 129 LLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKIC 302 LL +QE S Q + +++A L +H +RDLKP+N++ + + +C Sbjct: 38 LLTALQEG--LSWEQRLTVAKDVARGLQKIHKAEYVYRDLKPQNVMISFNGCAKINMC 93 >SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 31.9 bits (69), Expect = 0.49 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = +3 Query: 78 FEDTDKSTCLREINGGQLLGRI-----QEHHYFSEPQAAEIVREIANALHFLHG-KGVAH 239 FE+ +K + E+ G LG ++ FSE + I +I L ++H K + H Sbjct: 269 FEEKEKLYIIMELVEGAPLGEHFNSLKEKGTRFSEERIWHIFIQIVLGLRYIHKEKHIVH 328 Query: 240 RDLKPENIL 266 RDL P NI+ Sbjct: 329 RDLTPNNIM 337 >SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) Length = 634 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +3 Query: 129 LLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKIC 302 LL +QE S Q + +++A L +H +RDLKP+N++ + + +C Sbjct: 536 LLTALQEG--LSWEQRLTVAKDVARGLQKIHKAEYVYRDLKPQNVMISFNGCAKINMC 591 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 1/80 (1%) Frame = +3 Query: 141 IQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGG 320 ++++ SE + + ++ L LH G+ H D+KP N+ + GL KI DF L Sbjct: 566 LEKNDSVSEREVWNFLLDLTLGLKHLHDSGMVHMDIKPANVFFGHD-GL-CKIGDFGLVL 623 Query: 321 DQFHLESSEPV-ATPQLMTP 377 + +++++ + P M P Sbjct: 624 ELSKVDTADALEGDPMYMAP 643 >SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 31.9 bits (69), Expect = 0.49 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 120 GGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLK 251 GG+L +++ F + A + + +LH KG+ +RDLK Sbjct: 53 GGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLK 96 >SB_33599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.49 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -3 Query: 89 RVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 R FE S+S+ + SPG +++ PPPRWSS Sbjct: 2 RFFEGSLSYQLFEPSPGDPLVLERPPPRWSS 32 >SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 31.9 bits (69), Expect = 0.49 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = +3 Query: 159 FSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIG---LPVKICDFDLGGDQF 329 FS + ++ + + ++H K + +RD+KPEN L + + I DF L + Sbjct: 137 FSLKTVLMVALQLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEKTINIIDFGLAKEYI 196 Query: 330 HLESSEPVATPQLMTPVGSA 389 E+ + + + + G+A Sbjct: 197 DPETKKHIPYREHKSLTGTA 216 >SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) Length = 385 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 183 IVREIANALHFLHGKGVAHRDLKPENILCVYRIGLP-VKICDF 308 ++ ++ N L L VAHRDLK +N+L + P + ICDF Sbjct: 102 LLLQLLNGLVHLQEHQVAHRDLKSDNLLLDTSVYPPRLVICDF 144 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 31.5 bits (68), Expect = 0.64 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 2/28 (7%) Frame = -3 Query: 80 EDSMSWIMCACSPG--IIV*TPPPRWSS 3 ED++++ +CSPG +++ PPPRWSS Sbjct: 150 EDAVAFPSNSCSPGDPLVLERPPPRWSS 177 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 31.5 bits (68), Expect = 0.64 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 5/103 (4%) Frame = -3 Query: 296 LDRQTDPVHAQYVLRLQVPVRDALAVEEVQGVRYLADYXXXXXX*EVMVLLYATQELTAV 117 +D TD V + L R L Q V + + + +L+ + E Sbjct: 1 IDYSTDEVQLNLLQLLSATARQTLTYHCRQSVAW---FNNVSMKKDKALLMIGSNEFEFK 57 Query: 116 YFSKTGRLVRVFEDSMSWIMC---ACSPG--IIV*TPPPRWSS 3 + +V D I+ +CSPG +++ PPPRWSS Sbjct: 58 ASGTRKNMPKVIRDECKGILLTSNSCSPGDPLVLERPPPRWSS 100 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDF 308 +IA + ++H + H L+P+NI+ + L VK+ F Sbjct: 1041 QIAMVIQYIHQSDIVHCSLRPDNIMVAQQAPLKVKLTRF 1079 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENIL 266 ++ A+ FLH G+ HR + P N++ Sbjct: 619 DVLRAVKFLHQLGLVHRSICPSNVM 643 >SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 31.5 bits (68), Expect = 0.64 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +3 Query: 171 QAAEIVREIANALHFLHGK--GVAHRDLKPENILCVYRIG-LPVKICDFDL 314 + I+ ++AN L++LH + HRDL P+NIL + + + KI D L Sbjct: 111 EVVTIMLDVANGLNYLHTRIQPTIHRDLCPKNILILKKDSVITAKITDVGL 161 >SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) Length = 335 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 159 FSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILC-VYRIGLPVKICDFDL 314 FS + + + + ++H K HRD+KP+N L + + G V I DF L Sbjct: 63 FSIKTVLLLADQTISRIEYVHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGL 115 >SB_37212| Best HMM Match : zf-C2H2 (HMM E-Value=2e-23) Length = 827 Score = 31.5 bits (68), Expect = 0.64 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 81 EDTDKSTCLREINGGQLLGRIQEHHY-FSEPQAAEIVREIANALHFLHGKGVAHRDL 248 +D S +NGG L + H + + R+IA+ + FLH K HRDL Sbjct: 352 KDNKVSLITEFVNGGNLEELLMNHEETLNWATRVYLARDIASGMAFLHQKRFLHRDL 408 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -3 Query: 128 LTAVYFSKTGRLVRV-FEDSMSWIMCACSPG--IIV*TPPPRWSS 3 L A++ + GR V ++ I +CSPG +++ PPPRWSS Sbjct: 48 LLALFVNHVGRSCEVVYQHFPCLISNSCSPGDPLVLERPPPRWSS 92 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSS 55 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -3 Query: 80 EDSMSWIMCACSPG--IIV*TPPPRWSS 3 E S S + +CSPG +++ PPPRWSS Sbjct: 9 ERSASQVSNSCSPGDPLVLERPPPRWSS 36 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = -3 Query: 110 SKTGRLVRV-FEDSMSWIMCACSPG--IIV*TPPPRWSS 3 SKT R+ + F++ + +CSPG +++ PPPRWSS Sbjct: 21 SKTKRVGTLDFQNDCFYTSNSCSPGDPLVLERPPPRWSS 59 >SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 31.1 bits (67), Expect = 0.85 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +3 Query: 69 H*VFEDTDKSTCLREINGGQLLGRI-QEHHYFSEPQAAEIVREIANALHFLHGKGVAHRD 245 H +E T+ + E+ G L I + E EIA AL ++H G+ + D Sbjct: 62 HEWYETTNHIWMVVELCTGSTLADILSQDTGLPEATVKHFGAEIAKALFYIHTLGIVYCD 121 Query: 246 LKPENIL 266 LKP +L Sbjct: 122 LKPSKVL 128 >SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) Length = 888 Score = 31.1 bits (67), Expect = 0.85 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +3 Query: 69 H*VFEDTDKSTCLREINGGQLLGRI-QEHHYFSEPQAAEIVREIANALHFLHGKGVAHRD 245 H +E T+ + E+ G L I + E EIA AL ++H G+ + D Sbjct: 62 HEWYETTNHIWMVVELCTGSTLADILSQDTGLPEATVKHFGAEIAKALFYIHTLGIVYCD 121 Query: 246 LKPENIL 266 LKP +L Sbjct: 122 LKPSKVL 128 >SB_5853| Best HMM Match : Pkinase (HMM E-Value=3.6e-05) Length = 229 Score = 31.1 bits (67), Expect = 0.85 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 210 HFLHGKGVAHRDLKPENI 263 +++H GV HRDLKP NI Sbjct: 89 NYIHSAGVIHRDLKPSNI 106 >SB_4359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 170 ASGGDSPRDSERPALPPRQGRRAPGPEAGEHTVRV--PDRSAGQD 298 A+G D +RP PPR G+R P+ T + P RS +D Sbjct: 49 ATGNKVTNDDKRPPWPPRPGKRTFRPQESADTPSIFRPGRSVHED 93 >SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 31.1 bits (67), Expect = 0.85 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +3 Query: 183 IVREIANALHFLHG--KGVAHRDLKPENILCVYRIGLPVKIC 302 + R++ A+ +LH V H+D+KP N+L V +GL + C Sbjct: 403 VSRQLCQAVAYLHNLKPQVLHKDIKPANVL-VANVGLVMLFC 443 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSS 55 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = -3 Query: 137 TQELTAVYFSKTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 ++ +T V S+ + V E ++ + +CSPG +++ PPPRWSS Sbjct: 14 SRSITEVKLSRARHFLFVIE-VLTGLSNSCSPGDPLVLERPPPRWSS 59 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSS 55 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSS 55 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSS 55 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 83 FEDSM-SWIMCACSPG--IIV*TPPPRWSS 3 F+ +M S++ +CSPG +++ PPPRWSS Sbjct: 6 FDSNMCSFVSNSCSPGDPLVLERPPPRWSS 35 >SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 31.1 bits (67), Expect = 0.85 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +3 Query: 147 EHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 E + EP ++ +IA + FL HRDL NIL K+ DF L Sbjct: 347 EGQFLKEPTLIDMAAQIAAGMAFLEKMNYIHRDLAARNILVGENYA--CKVADFGL 400 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSS 55 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 31 SISLISNSCSPGDPLVLERPPPRWSS 56 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.1 bits (67), Expect = 0.85 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = -3 Query: 143 YATQEL-TAVYFSKTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 +ATQ L T T +L +F S +CSPG +++ PPPRWSS Sbjct: 10 HATQLLETPSIAIATHKLNTLFIPSTQMASNSCSPGDPLVLERPPPRWSS 59 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 30 SISLISNSCSPGDPLVLERPPPRWSS 55 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S+S I +CSPG +++ PPPRWSS Sbjct: 28 SISLISNSCSPGDPLVLERPPPRWSS 53 >SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 893 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 8/70 (11%) Frame = +3 Query: 192 EIANALHFLHGKG---VAHRDLKPENILCVYRIGLP-----VKICDFDLGGDQFHLESSE 347 +IA + +LH + + HRDLK NIL Y+I +KI DF L + + Sbjct: 188 QIAQGMFYLHSEAPVTIVHRDLKSGNILLHYKINESDFNNILKITDFGLAREIANTTRMS 247 Query: 348 PVATPQLMTP 377 T M P Sbjct: 248 AAGTYAWMAP 257 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 30.7 bits (66), Expect = 1.1 Identities = 29/102 (28%), Positives = 38/102 (37%) Frame = -2 Query: 570 RSS*QARQFSPRSHPQSAPQSARNGGYPQSRRRDHAERPQSSACRRRAAEPANRHHSGPE 391 R S + + RS +SAR PQ R R S+ R R++ +H S Sbjct: 224 RKSRKRSESRSRSRSPKKSRSARRSRSPQKSRSPQRSRSPRSSKRYRSSRSHRKHRSHSR 283 Query: 390 *RYQPVS*AEAWPRAR*TRGETDPLRDRSRIS*PADRSGTRT 265 R P S PR R P R R S RS +R+ Sbjct: 284 SR-SPRSKRSRSPRKRRRSKSRSPRRYRDSSSCRRRRSRSRS 324 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = -2 Query: 537 RSHPQSAPQSARNGGYPQSRRRDHAERPQ----SSACRRRAAEPANR 409 RSH +S ++ P+ RRR + P+ SS+CRRR + +R Sbjct: 279 RSHSRSRSPRSKRSRSPRKRRRSKSRSPRRYRDSSSCRRRRSRSRSR 325 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S++++ +CSPG +++ PPPRWSS Sbjct: 15 SIAFVSNSCSPGDPLVLERPPPRWSS 40 >SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +3 Query: 159 FSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQFHLE 338 F++ + ++A + FL + HRDL N+L L K+ DF L D + E Sbjct: 534 FTQMELVSAAYQVARGMEFLASRRCIHRDLAARNVLIADDYVL--KVADFGLARDVYKNE 591 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +3 Query: 120 GGQLLGRIQEH--HYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPV 293 GG + +Q+ E + + +I AL +H + HRDLK +NIL + + V Sbjct: 85 GGTIYDYLQQRGGKLMDEDEILRLFVQILLALRHVHKGQILHRDLKTQNIL-LNKKRKVV 143 Query: 294 KICDFDL 314 KI DF + Sbjct: 144 KIGDFGI 150 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -3 Query: 89 RVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 R + ++S+ +CSPG +++ PPPRWSS Sbjct: 4 RNIDTNVSYTSNSCSPGDPLVLERPPPRWSS 34 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 M ++ +CSPG +++ PPPRWSS Sbjct: 31 MEYLSNSCSPGDPLVLERPPPRWSS 55 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENI-LCVYRIGL-PVKICDFD 311 ++ A+ +H G+ H+D+K +N+ LC+ + L K+ DFD Sbjct: 647 QVCMAVDHIHTSGIIHKDIKAKNVLLCLNQGELHRAKLSDFD 688 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 3/26 (11%) Frame = -3 Query: 71 MSWIMC-ACSPG--IIV*TPPPRWSS 3 + W++ +CSPG +++ PPPRWSS Sbjct: 89 IEWVLSNSCSPGDPLVLERPPPRWSS 114 >SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1176 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 198 ANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQFHLESS 344 A +L G+GV HRDL NIL L KI DF L + +++ S Sbjct: 1091 AKPQEYLAGRGVVHRDLAARNILVGEEKVL--KISDFGLSREGVYVKRS 1137 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 4/32 (12%) Frame = -3 Query: 86 VFEDSMSWIMCA--CSPG--IIV*TPPPRWSS 3 V +S WI+ + CSPG +++ PPPRWSS Sbjct: 2 VLVNSNFWIVTSNSCSPGDPLVLERPPPRWSS 33 >SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENIL 266 +I A +LH + +RDLKPEN+L Sbjct: 11 QIVLAFEYLHSLDLIYRDLKPENLL 35 >SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 + W +CSPG +++ PPPRWSS Sbjct: 14 LGWGSNSCSPGDPLVLERPPPRWSS 38 >SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGD 323 +IA + FL K HRDL N+L G +KI DF L D Sbjct: 469 QIAQGMDFLASKKCIHRDLAARNVL--VDEGYALKIGDFGLARD 510 >SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 186 VREIANALHFLHGKGVAHRDLKPENILCVY 275 ++ IA L F H KG H DLK N++ Y Sbjct: 343 LKTIAETLLFCHQKGFLHNDLKQNNVVFHY 372 >SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 387 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQF 329 ++++ + L HRDL N C+ GL VKI DF + D + Sbjct: 74 QVSSGMEHLQSMRFVHRDLATRN--CLVGDGLVVKIADFGMSRDVY 117 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQF 329 ++++ + L HRDL N C+ GL VKI DF + D + Sbjct: 257 QVSSGMEHLQSMRFVHRDLATRN--CLVGDGLVVKIADFGMSRDVY 300 >SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) Length = 279 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 216 LHGKGVAHRDLKPENILCVYRIGLPVKICDF 308 LH + H DLKPENIL + +K+ DF Sbjct: 12 LHKNRIIHCDLKPENILLKQQGRSGIKVIDF 42 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -3 Query: 143 YATQELTAVYFSKTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 + + LT + S +LVR ++ I +CSPG +++ PPPRWSS Sbjct: 94 WKARPLTEMGRSLCRQLVRA-KNQKEIISNSCSPGDPLVLERPPPRWSS 141 >SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +2 Query: 395 GPEWCLFAGSAARLRQALDCGRSA*SRLLLCGYPPFRADCGADCGWERGENCRAC 559 GP + G LR+ + CGR + + C A C W+ C C Sbjct: 965 GPVETVLTGIGVNLRECMVCGRGLNRKYIYCETESCEAIYCRTCFWDLENKCLGC 1019 >SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 786 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 ++ + +LH G+ HRDL NIL + KI DF L Sbjct: 3 QVVKGVLYLHSHGIIHRDLSLGNIL--LSSDMDAKIADFGL 41 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -3 Query: 77 DSMSWIMCACSPG--IIV*TPPPRWSS 3 D +S + +CSPG +++ PPPRWSS Sbjct: 6 DVISELSNSCSPGDPLVLERPPPRWSS 32 >SB_59772| Best HMM Match : dDENN (HMM E-Value=1.6e-24) Length = 423 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -2 Query: 615 PLGGNVYRPSCIELKRSS*QARQFSPRSHPQSAPQSARNGGYPQSRRRDHAERPQSSACR 436 PLG NVY + + S + SPR P+ P++ + S + + E+P R Sbjct: 133 PLGENVYGNTSSADEESGFGSAGGSPRGSPKLKPRAKKQKSPSSSPKTERREKPSRVRPR 192 Query: 435 RRAA 424 R +A Sbjct: 193 RMSA 196 >SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) Length = 355 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENIL 266 ++ + + ++H K HRD+KP+N L Sbjct: 121 QMISRIEYVHNKNFIHRDIKPDNFL 145 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 16/83 (19%) Frame = +3 Query: 123 GQLLG-----RIQEHHYFSEPQ--------AAEIVR---EIANALHFLHGKGVAHRDLKP 254 G LLG R +E Y+S+P+ + +++R ++A+ + +L + + HRDL Sbjct: 506 GDLLGYLRKSRGEEDDYYSDPEIKPKTSLSSQQLIRFAWQVADGMEYLSSQKIIHRDLAA 565 Query: 255 ENILCVYRIGLPVKICDFDLGGD 323 NIL G K+ DF + D Sbjct: 566 RNIL--VGEGEVCKVADFGMAKD 586 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 M ++ +CSPG +++ PPPRWSS Sbjct: 1 MLYVSNSCSPGDPLVLERPPPRWSS 25 >SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 W +CSPG +++ PPPRWSS Sbjct: 19 WESNSCSPGDPLVLERPPPRWSS 41 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S S I +CSPG +++ PPPRWSS Sbjct: 2 STSKISNSCSPGDPLVLERPPPRWSS 27 >SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 W +CSPG +++ PPPRWSS Sbjct: 2 WPSNSCSPGDPLVLERPPPRWSS 24 >SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) Length = 216 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +3 Query: 162 SEPQAAEIVREIANALHFLHGKGVAHRDLKPENIL 266 +E AA ++R+ +AL +LH + H D++ + I+ Sbjct: 138 NEEDAAFVMRQTLDALKYLHSNNIVHLDVRGDFII 172 >SB_57129| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 456 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 180 EIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 EI ++A + +L K HRDL N+L + K+ DF L Sbjct: 207 EIALDVAQGMDYLASKRCVHRDLAARNVLIADGV---AKVADFGL 248 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 +S I +CSPG +++ PPPRWSS Sbjct: 31 VSLISNSCSPGDPLVLERPPPRWSS 55 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -3 Query: 158 VMVLLYATQELTAVYFSKTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 +M+++ T +T V + R D S +CSPG +++ PPPRWSS Sbjct: 81 MMMMIMMTMVMTMVLMMTM--VSRNIPDHYSSPSNSCSPGDPLVLERPPPRWSS 132 >SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +3 Query: 132 LGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLKPEN 260 L R Q FS + +I ++ +H G HRD+KP N Sbjct: 11 LRRSQPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSN 53 >SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +3 Query: 123 GQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRDLK 251 G + I++H +E + R+I + +LH + HRD+K Sbjct: 1 GSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 43 >SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +3 Query: 231 VAHRDLKPENILCVYR-IGLPVKICDFDL 314 V HRDLKPEN+L + VK+ DF L Sbjct: 19 VHHRDLKPENLLLASKEKNAAVKLADFGL 47 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -3 Query: 137 TQELTAVYFSKTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 T+ +T + F T + + S S CSPG +++ PPPRWSS Sbjct: 13 TRRVTVITFVHTTSYLTIHSASNS-----CSPGDPLVLERPPPRWSS 54 >SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -3 Query: 92 VRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 +RVFE + +CSPG +++ PPPRWSS Sbjct: 13 IRVFESN------SCSPGDPLVLERPPPRWSS 38 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 1/83 (1%) Frame = +3 Query: 69 H*VFEDTDKSTCLREI-NGGQLLGRIQEHHYFSEPQAAEIVREIANALHFLHGKGVAHRD 245 H F+D L E+ + L+ ++ +EP+ +++ A +LH + V HRD Sbjct: 497 HGSFQDEMNFYILLELCSRKSLVQMLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRD 556 Query: 246 LKPENILCVYRIGLPVKICDFDL 314 +K N + +++ DF L Sbjct: 557 IKVGNFF--INSNMELRLGDFGL 577 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 207 LHFLHGKGVAHRDLKPENIL 266 + ++H K HRD+KP+N L Sbjct: 121 IEYVHNKNFIHRDIKPDNFL 140 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 +I +CSPG +++ PPPRWSS Sbjct: 260 YISNSCSPGDPLVLERPPPRWSS 282 >SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = +2 Query: 182 DSPRDSERPALPPRQGRRAP------GPEAGEHTVRVPDR 283 D P A+PPR+G R P G EA + RVPDR Sbjct: 279 DDPLQVPFQAIPPRRGIRRPMFLYYPGDEAPDERFRVPDR 318 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -3 Query: 122 AVYFSKTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 A Y+ L+ V S+S +CSPG +++ PPPRWSS Sbjct: 42 AYYYKDEWPLLIVVPSSIS---NSCSPGDPLVLERPPPRWSS 80 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -3 Query: 77 DSMSWIMCACSPG--IIV*TPPPRWSS 3 D ++ I +CSPG +++ PPPRWSS Sbjct: 47 DYVNDISNSCSPGDPLVLERPPPRWSS 73 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -3 Query: 68 SWIMCACSPG--IIV*TPPPRWSS 3 S I +CSPG +++ PPPRWSS Sbjct: 2 SQISNSCSPGDPLVLERPPPRWSS 25 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -3 Query: 89 RVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 ++ E + + +CSPG +++ PPPRWSS Sbjct: 19 QIAEKHVKFTSNSCSPGDPLVLERPPPRWSS 49 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 M + +CSPG +++ PPPRWSS Sbjct: 1 MEHVSNSCSPGDPLVLERPPPRWSS 25 >SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCV 272 +I A+ F+HG G H D+K E + V Sbjct: 26 DILKAVEFMHGNGFIHNDIKGETKMSV 52 >SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) Length = 561 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 162 SEPQAAEIVREIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDL 314 +E Q + +A + L K HRDL N+L +GL K+ DF L Sbjct: 499 NERQLLFLALGVARGMAHLEEKQCIHRDLAARNVL--VGLGLVAKVADFGL 547 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 M + +CSPG +++ PPPRWSS Sbjct: 1 MEGVSNSCSPGDPLVLERPPPRWSS 25 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 107 KTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 K + RV E ++ + +CSPG +++ PPPRWSS Sbjct: 18 KRKKTFRVKEGKIA-VSNSCSPGDPLVLERPPPRWSS 53 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 3/24 (12%) Frame = -3 Query: 65 WIMC-ACSPG--IIV*TPPPRWSS 3 WI +CSPG +++ PPPRWSS Sbjct: 157 WIASNSCSPGDPLVLERPPPRWSS 180 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 +I +CSPG +++ PPPRWSS Sbjct: 9 YISNSCSPGDPLVLERPPPRWSS 31 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/25 (44%), Positives = 19/25 (76%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 ++++ +CSPG +++ PPPRWSS Sbjct: 512 VTFLSNSCSPGDPLVLERPPPRWSS 536 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 83 FEDSMSWIMC-ACSPG--IIV*TPPPRWSS 3 F + +S+++ +CSPG +++ PPPRWSS Sbjct: 10 FVELISFLISNSCSPGDPLVLERPPPRWSS 39 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/27 (40%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -3 Query: 77 DSMSWIMCACSPG--IIV*TPPPRWSS 3 +++ ++ +CSPG +++ PPPRWSS Sbjct: 5 NAVLFVSNSCSPGDPLVLERPPPRWSS 31 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = -3 Query: 116 YFSKTGRLVRVFEDSMSW---IMCACSPG--IIV*TPPPRWSS 3 +F+ T + S+ W + +CSPG +++ PPPRWSS Sbjct: 3 HFTDTLISANILRFSIFWTDRLSNSCSPGDPLVLERPPPRWSS 45 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -3 Query: 77 DSMSWIMCACSPG--IIV*TPPPRWSS 3 ++ S+ +CSPG +++ PPPRWSS Sbjct: 9 NNTSFTSNSCSPGDPLVLERPPPRWSS 35 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 Query: 104 SSRNKRRSAPGSHTGAPLLLRAASGGDSPRDSERPALPPRQGRRAPGP 247 SSR PG + P + SGG+ P P PP++G P P Sbjct: 236 SSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP-PPKRGSSNPPP 282 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/31 (35%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -3 Query: 89 RVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 +++++ ++ +CSPG +++ PPPRWSS Sbjct: 30 QIWKNHKNYRSNSCSPGDPLVLERPPPRWSS 60 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 4/25 (16%) Frame = -3 Query: 65 WIMCA--CSPG--IIV*TPPPRWSS 3 WI + CSPG +++ PPPRWSS Sbjct: 47 WIFLSNSCSPGDPLVLERPPPRWSS 71 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -3 Query: 137 TQELTAVYFSKTGRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 T EL + ++ + + E +S +CSPG +++ PPPRWSS Sbjct: 1044 TSELEKLRLERSAKKSELEEKEVS---NSCSPGDPLVLERPPPRWSS 1087 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 Query: 104 SSRNKRRSAPGSHTGAPLLLRAASGGDSPRDSERPALPPRQGRRAPGP 247 SSR PG + P + SGG+ P P PP++G P P Sbjct: 148 SSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP-PPKRGSSNPPP 194 >SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGD 323 ++A + +L K HRDL N+L +KI DF L D Sbjct: 588 QVARGMEYLESKKCIHRDLAARNVL--VSDNHVIKIADFGLARD 629 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 107 KTGRLVRVFEDSMSWIMCACSPGIIV*TPPPRWSS 3 KTG V +F + A +++ PPPRWSS Sbjct: 2 KTGHKVSLFVSENKELRLAPGDPLVLERPPPRWSS 36 >SB_1299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +2 Query: 425 AARLRQALDCGRSA*SRLLLCGYPPFRADCGADCG---WERGENCRACQE 565 A R+ + L CG S SR + CG FR G CG RG C A +E Sbjct: 311 AVRVSRGLFCGASRVSREIFCG--AFRVSRGIFCGAFRVSRGLLCGALRE 358 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -3 Query: 80 EDSMSWIMCACSPG--IIV*TPPPRWSS 3 + + ++ +CSPG +++ PPPRWSS Sbjct: 72 DHELRFLSNSCSPGDPLVLERPPPRWSS 99 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 +I +CSPG +++ PPPRWSS Sbjct: 46 FISNSCSPGDPLVLERPPPRWSS 68 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S S+ +CSPG +++ PPPRWSS Sbjct: 16 SYSFRSNSCSPGDPLVLERPPPRWSS 41 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S + I +CSPG +++ PPPRWSS Sbjct: 10 SANIISNSCSPGDPLVLERPPPRWSS 35 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -3 Query: 77 DSMSWIMCACSPG--IIV*TPPPRWSS 3 D + + +CSPG +++ PPPRWSS Sbjct: 20 DCHAHVSNSCSPGDPLVLERPPPRWSS 46 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 101 GRLVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 G ++ FE S S CSPG +++ PPPRWSS Sbjct: 53 GEILAAFELSNS-----CSPGDPLVLERPPPRWSS 82 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 7/60 (11%) Frame = -3 Query: 161 EVMVLLYATQELTAVYFSKTGRLVRVFEDSMSWIMC-----ACSPG--IIV*TPPPRWSS 3 +++V+ A + ++ V + L RV S+++ +CSPG +++ PPPRWSS Sbjct: 7 KIVVVFGAVRWISTVSKRERRALARVDHPPCSYLVDPARSNSCSPGDPLVLERPPPRWSS 66 >SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) Length = 345 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = -3 Query: 83 FEDSMSW-IMCACSPG--IIV*TPPPRWSS 3 F + W + +CSPG +++ PPPRWSS Sbjct: 213 FASTTFWGLSNSCSPGDPLVLERPPPRWSS 242 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 95 LVRVFEDSMSWIMCACSPG--IIV*TPPPRWSS 3 L+ +F ++ +CSPG +++ PPPRWSS Sbjct: 160 LMGLFMQYELFLSNSCSPGDPLVLERPPPRWSS 192 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -3 Query: 71 MSWIMCACSPG--IIV*TPPPRWSS 3 +S + +CSPG +++ PPPRWSS Sbjct: 14 VSKVSNSCSPGDPLVLERPPPRWSS 38 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 +I +CSPG +++ PPPRWSS Sbjct: 6 FISNSCSPGDPLVLERPPPRWSS 28 >SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 196 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 192 EIANALHFLHGKGVAHRDLKPENILCVYRIGLPVKICDFDLGGDQFHLE 338 +++ A+ FL + HRDL N+L +KI DF L D + E Sbjct: 73 QVSRAMQFLASRRCVHRDLAARNVL--VGENYVMKIADFGLARDIYKEE 119 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/23 (47%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 65 WIMCACSPG--IIV*TPPPRWSS 3 ++ +CSPG +++ PPPRWSS Sbjct: 26 YVSNSCSPGDPLVLERPPPRWSS 48 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -3 Query: 74 SMSWIMCACSPG--IIV*TPPPRWSS 3 S + I +CSPG +++ PPPRWSS Sbjct: 10 SANIISNSCSPGDPLVLERPPPRWSS 35 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 14 SCSPGDPLVLERPPPRWSS 32 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 12 SCSPGDPLVLERPPPRWSS 30 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 28 SCSPGDPLVLERPPPRWSS 46 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 5 SCSPGDPLVLERPPPRWSS 23 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 29 SCSPGDPLVLERPPPRWSS 47 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 186 SCSPGDPLVLERPPPRWSS 204 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 81 SCSPGDPLVLERPPPRWSS 99 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 17 SCSPGDPLVLERPPPRWSS 35 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 351 SCSPGDPLVLERPPPRWSS 369 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 8 SCSPGDPLVLERPPPRWSS 26 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 20 SCSPGDPLVLERPPPRWSS 38 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 29 SCSPGDPLVLERPPPRWSS 47 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 13 SCSPGDPLVLERPPPRWSS 31 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 104 SCSPGDPLVLERPPPRWSS 122 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 33 SCSPGDPLVLERPPPRWSS 51 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 9 SCSPGDPLVLERPPPRWSS 27 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 6 SCSPGDPLVLERPPPRWSS 24 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 84 SCSPGDPLVLERPPPRWSS 102 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 4 SCSPGDPLVLERPPPRWSS 22 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 384 SCSPGDPLVLERPPPRWSS 402 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 26 SCSPGDPLVLERPPPRWSS 44 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 16 SCSPGDPLVLERPPPRWSS 34 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = -3 Query: 53 ACSPG--IIV*TPPPRWSS 3 +CSPG +++ PPPRWSS Sbjct: 24 SCSPGDPLVLERPPPRWSS 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,460,503 Number of Sequences: 59808 Number of extensions: 510573 Number of successful extensions: 3800 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3787 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -