BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M22 (446 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788... 28 3.9 03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257... 28 3.9 02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478... 27 6.9 04_04_1189 + 31586991-31587291,31587358-31587397,31587449-315875... 27 9.1 04_04_0156 + 23160681-23160862,23161090-23161179,23163145-231634... 27 9.1 >11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535, 7881648-7882304 Length = 451 Score = 27.9 bits (59), Expect = 3.9 Identities = 22/85 (25%), Positives = 37/85 (43%) Frame = +3 Query: 189 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTTQEIKTSYPHN 368 +N F+ L PYP ++HF+ V+ + S + TNS F + + P + Sbjct: 252 VNEFQTNLVPYP--RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRH 309 Query: 369 FKVRQPRLNHKPFSVTIDVQSDIAT 443 K L ++ V DV + +AT Sbjct: 310 GKYMACCLMYRGDVVPKDVNAAVAT 334 >03_05_0974 + 29324025-29324117,29325064-29325298,29325385-29325755, 29325864-29326520 Length = 451 Score = 27.9 bits (59), Expect = 3.9 Identities = 22/85 (25%), Positives = 37/85 (43%) Frame = +3 Query: 189 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTTQEIKTSYPHN 368 +N F+ L PYP ++HF+ V+ + S + TNS F + + P + Sbjct: 252 VNEFQTNLVPYP--RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRH 309 Query: 369 FKVRQPRLNHKPFSVTIDVQSDIAT 443 K L ++ V DV + +AT Sbjct: 310 GKYMACCLMYRGDVVPKDVNAAVAT 334 >02_05_0890 - 32546918-32547088,32547224-32547334,32547705-32547884, 32547960-32548064,32548333-32548431,32548524-32548679, 32548772-32548850,32549213-32549278,32549382-32549536, 32549675-32550034,32550150-32550305,32550779-32550856, 32551471-32551812 Length = 685 Score = 27.1 bits (57), Expect = 6.9 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +1 Query: 1 PICMKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLT 126 PICM + MC V HL+H + P C LT Sbjct: 61 PICMAVIKDAFLTACGHSFCYMCIVTHLSHKSDCPCCGNYLT 102 >04_04_1189 + 31586991-31587291,31587358-31587397,31587449-31587534, 31587535-31588097,31588250-31589913,31589956-31590066, 31590152-31591181,31591234-31591406,31591535-31591814, 31592275-31592331 Length = 1434 Score = 26.6 bits (56), Expect = 9.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 189 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQ 305 IN+ ++ L PY L F+G DVV+ + +T F + Q Sbjct: 639 INSLQNSLNPYHLRYLEFIGA-YGDVVLPQALTSFYHLQ 676 >04_04_0156 + 23160681-23160862,23161090-23161179,23163145-23163433, 23164574-23164669,23164755-23165123 Length = 341 Score = 26.6 bits (56), Expect = 9.1 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 99 HTFMPSALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYP--QEKLHFVGVKIND 263 H + L+ YQ LR P+ +Q R +G ++ + P P QE VG+ ++D Sbjct: 208 HVNVIKRLEDYQAPLRPPSPFQGVGRTLGGGSSAEESQAPAPATQEPRRSVGIVVDD 264 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,760,894 Number of Sequences: 37544 Number of extensions: 227601 Number of successful extensions: 533 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -