BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M20 (181 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23700.1 68414.m02992 protein kinase family protein contains ... 26 4.0 >At1g23700.1 68414.m02992 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 473 Score = 25.8 bits (54), Expect = 4.0 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 46 SIEFQKRHTPTPVLL*SRNNSKSPD*KSGVRFSWFFHSVCAEVL 177 ++E H+PT VL + NS P+ + +FS F + A L Sbjct: 207 ALELAHGHSPTTVLPLNLQNSPFPNYEEDTKFSKSFRELVAACL 250 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,596,358 Number of Sequences: 28952 Number of extensions: 76471 Number of successful extensions: 150 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 12,070,560 effective HSP length: 39 effective length of database: 10,941,432 effective search space used: 218828640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -